DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and Dnajc18

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_006254608.1 Gene:Dnajc18 / 291677 RGDID:1310237 Length:357 Species:Rattus norvegicus


Alignment Length:149 Identity:41/149 - (27%)
Similarity:61/149 - (40%) Gaps:32/149 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71
            :||.:|.....|:.|::..||::||::.  |.||                :.:| |....:..:.
  Rat    82 NYYDILGVSHNASDEELKKAYKKLALKF--HPDK----------------NCAP-GATDAFKAIG 127

  Fly    72 MAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQY------DGDHMKVYERVFGSYSPYAN 130
            .||.||.|...|..||.:|:    |.|.|......||.|      |....:::...||.:.|..|
  Rat   128 NAFAVLSNPDKRLRYDEYGD----EQVTLTAPRARPYHYYRDVEADISPEELFNVFFGGHFPSGN 188

  Fly   131 VIDAISN--PPSLYATRQH 147
             |...||  ..|.|..|:|
  Rat   189 -IHMFSNVTDDSHYYRRRH 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 41/149 (28%)
DnaJ 7..87 CDD:278647 20/79 (25%)
DnaJ_C 156..335 CDD:199909
Dnajc18XP_006254608.1 DnaJ 82..143 CDD:278647 20/79 (25%)
DUF1977 250..349 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.