DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and DNAJB5

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001128477.1 Gene:DNAJB5 / 25822 HGNCID:14887 Length:420 Species:Homo sapiens


Alignment Length:384 Identity:109/384 - (28%)
Similarity:164/384 - (42%) Gaps:89/384 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKD--EQDFVPLAQEGRLTHLSPMGEPRQWAY 69
            |||.:|..|.||.:::|..|||::|::..|.::|:.  |:.|..:|:                  
Human    76 DYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAE------------------ 122

  Fly    70 VNMAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQY--DGDHMKVYERVFGSYSPYANVI 132
               |:|||.:...|.:||::||.||..|.....|....:.|  .||....:...||..:|: ::.
Human   123 ---AYDVLSDPKKRGLYDQYGEEGLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPF-DIF 183

  Fly   133 DAISN----------------------------------------PPSLYATRQHGIGVRSKDAS 157
            .|.|.                                        |..||..|      :.:|..
Human   184 FASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRR------KVQDPP 242

  Fly   158 TERIIELSLEEVRTGCVKLMNVWRQEI-VDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDR 221
            ....:.:||||:..|..|.|.:.|:.: .|.:..|.|.:  .|.:.|..|...||:..|.:|||.
Human   243 VVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDK--ILHIVIKRGWKEGTKITFPKEGDA 305

  Fly   222 YPATIPGDIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVITDVVQ 286
            .|..||.||:|:..||||..| ||:..:::|...|.|.:|..|.|..|.|:|.|.:.:...||::
Human   306 TPDNIPADIVFVLKDKPHAHF-RRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIK 369

  Fly   287 PGYTKVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPKYLTPHMKHITRE 345
            ||..|.:..||||             ..|...|.||||:||...||..|||..:.|.::
Human   370 PGTVKRLRGEGLP-------------FPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 109/384 (28%)
DnaJ 7..87 CDD:278647 22/81 (27%)
DnaJ_C 156..335 CDD:199909 62/179 (35%)
DNAJB5NP_001128477.1 DnaJ 72..415 CDD:223560 109/382 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.