DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and SPBC405.06

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_596309.1 Gene:SPBC405.06 / 2540773 PomBaseID:SPBC405.06 Length:413 Species:Schizosaccharomyces pombe


Alignment Length:403 Identity:93/403 - (23%)
Similarity:137/403 - (33%) Gaps:143/403 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAY---- 69
            |.:|:....|:.|:|..:|:|||  |..|.||                  :|:.|..:.|.    
pombe     8 YDILEVHFEASAEEIKKSYKRLA--LLHHPDK------------------APIHEKEEAAERFRG 52

  Fly    70 VNMAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQYDG--DHMKVYERVFG----SYSPY 128
            |..|:|:|.:...|.:||.:|.......           |:||  :...|..::||    :..|.
pombe    53 VQEAYDILKDPESREMYDMYGMNSDSNS-----------QFDGGVNLDDVLAQMFGMNFEAGGPG 106

  Fly   129 ANVIDAISNPPSLYATRQHGIGVRSKDASTERII---ELSLEEVRTGCVKLMNVWRQEIVDAKES 190
            .||                   .|.:......:|   |:|||::..|....:...|..:....:.
pombe   107 KNV-------------------PRDRKRRGSDVIHDYEISLEDMFKGKEVKLRATRNTLCPRCQG 152

  Fly   191 RLEKR------------------------KHTLKLNIAPGTTAGTRFCFK--------------- 216
            |..||                        .|.....:...|..|....|:               
pombe   153 RGGKRFAKEKPCLSCDGKGVKQHLKHVGPHHVTNSQVICDTCNGKGVSFRGKDRCKHCKGSGTVP 217

  Fly   217 -------------EEGDR----------YPATIPGDIIFIAADKPHPDFERRNQHDLVYRQSIGL 258
                         :|.|:          |..| |||:|.....||||.|||... ||..:..|.|
pombe   218 EQRMLSFFVNRSAKENDKIIQRGMADEAYGIT-PGDVILQLHQKPHPVFERLGD-DLKAKLKISL 280

  Fly   259 CQAFTGFT-FFICTLDRRQLKVV--ITDVVQPGYTKVVPLEGLPKCRNLDAVTAIKEANKKVEQF 320
            .:|.|||. ..:.|||.|.|:.|  |..::.||...::|.||:.|             :.|.:..
pombe   281 AEALTGFNRVILTTLDGRGLEYVQPIGKILHPGDCLIIPGEGMYK-------------DSKTDLR 332

  Fly   321 GDLIIEFDYIFPK 333
            |||.:|.|..|||
pombe   333 GDLYLEVDIEFPK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 93/403 (23%)
DnaJ 7..87 CDD:278647 21/81 (26%)
DnaJ_C 156..335 CDD:199909 59/246 (24%)
SPBC405.06NP_596309.1 DnaJ 5..379 CDD:223560 93/403 (23%)
DnaJ 7..70 CDD:278647 21/81 (26%)
DnaJ_C 118..346 CDD:199909 59/243 (24%)
DnaJ_CXXCXGXG 147..214 CDD:279074 7/66 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.