DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and CG30156

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster


Alignment Length:293 Identity:60/293 - (20%)
Similarity:100/293 - (34%) Gaps:93/293 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKD--EQDFVPLAQ--------EGRLTH--LS 59
            ::|.||.....||..::..||.:||:||.|.::|..  ||.|..:::        :.|:.:  .:
  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIAT 160

  Fly    60 PMG-----EPRQWAYVNMAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQYDGDHMKVYE 119
            .:|     :|.|:.      |..|.       ..|.||   .|..|...:..||:.....|...:
  Fly   161 AVGDCHDQDPSQYK------DYRGE-------SEFNEA---NGNDLGAAFRRPYRGANQRMPQRQ 209

  Fly   120 RVFGSYSPYANVIDA----------ISNPP--SLYATRQHG---------IGVRSKDASTERIIE 163
            .::.:......|:.|          |:..|  |...||.|.         |.......:..:..|
  Fly   210 SLYQTQQLVIGVVAALVFLFVTMHFIAGAPAYSFTLTRTHSARRLSRTNHIAYYMNPTTLSKYTE 274

  Fly   164 LSLEEVRTGCVKLMNVWRQEIVDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPATIPG 228
            ..|.|:.              |:.:|..:...||.               |.:|...|       
  Fly   275 QQLAELE--------------VEIEEVYISDLKHK---------------CRQERSWR------- 303

  Fly   229 DIIFIAADKPHPDFERRNQHDLVYRQSIGLCQA 261
            |.:|:.|.:.:.| ::..||  |.:.|...|||
  Fly   304 DNLFLRARQGNND-QKLLQH--VSQMSTPACQA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 60/293 (20%)
DnaJ 7..87 CDD:278647 22/96 (23%)
DnaJ_C 156..335 CDD:199909 21/106 (20%)
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 17/60 (28%)
DUF1977 237..334 CDD:286411 27/136 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458978
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.