DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and DNAJC21

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_011512267.2 Gene:DNAJC21 / 134218 HGNCID:27030 Length:676 Species:Homo sapiens


Alignment Length:404 Identity:84/404 - (20%)
Similarity:141/404 - (34%) Gaps:158/404 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVNM 72
            :|..|...|.|::|::..|||:||::.  |.||             .|.:.:...|  |:..:..
Human    91 HYEALGVRRDASEEELKKAYRKLALKW--HPDK-------------NLDNAAEAAE--QFKLIQA 138

  Fly    73 AFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQYD----------------GDHMKVYERV 121
            |:|||.:...||.||...||      :|..|:...||.|                ||..|     
Human   139 AYDVLSDPQERAWYDNHREA------LLKGGFDGEYQDDSLDLLRYFTVTCYSGYGDDEK----- 192

  Fly   122 FGSYSPYANVIDAISNPPSLYATRQHGIGVRSKDASTERIIELSLEEVRT--------------- 171
             |.|:.|.||.:.|:.                  ...|.::|..:::..|               
Human   193 -GFYTVYRNVFEMIAK------------------EELESVLEEEVDDFPTFGDSQSDYDTVVHPF 238

  Fly   172 ------GCVKLMNVWRQEIVDAKE--SRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPATIPG 228
                  .|.:....|::| .|.::  :|.|||                  ..::|          
Human   239 YAYWQSFCTQKNFAWKEE-YDTRQASNRWEKR------------------AMEKE---------- 274

  Fly   229 DIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVITDVVQPGYTKVV 293
                   :|...|..|:.:::|| ||.:.          ||...|:|         || .:.|:|
Human   275 -------NKKIRDKARKEKNELV-RQLVA----------FIRKRDKR---------VQ-AHRKLV 311

  Fly   294 PLEGLPKCRNLDAV---TAIKEANKKVEQFGDLIIEFDYIFPKYLTPHMKHITREFFREF----- 350
            ..:...|.|..:.:   ..:|:| |.|||:.    |..::....|...::.:...:.:||     
Human   312 EEQNAEKARKAEEMRRQQKLKQA-KLVEQYR----EQSWMTMANLEKELQEMEARYEKEFGDGSD 371

  Fly   351 --RKLEIELEEEEE 362
              ...|.||::||:
Human   372 ENEMEEHELKDEED 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 79/392 (20%)
DnaJ 7..87 CDD:278647 22/78 (28%)
DnaJ_C 156..335 CDD:199909 36/204 (18%)
DNAJC21XP_011512267.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.