DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and DNAJB4

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001304028.1 Gene:DNAJB4 / 11080 HGNCID:14886 Length:337 Species:Homo sapiens


Alignment Length:364 Identity:105/364 - (28%)
Similarity:167/364 - (45%) Gaps:60/364 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71
            |||.:|...:||:.|.|..|||:.|::..|.::|                  ||..| .::..|.
Human     4 DYYCILGIEKGASDEDIKKAYRKQALKFHPDKNK------------------SPQAE-EKFKEVA 49

  Fly    72 MAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQY--DGDHMKVYERVFGSYSPY------ 128
            .|::||.:...|.|||:|||.||..|....:|....::|  .||....:...||..:|:      
Human    50 EAYEVLSDPKKREIYDQFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGR 114

  Fly   129 -------ANVIDAISNPPSLYATRQHGIGVRSKDASTERI---------IELSLEEVRTGCVKLM 177
                   :..::...:|.|.:....:|...........|:         :.:||||:.:||.|.|
Human   115 RMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRM 179

  Fly   178 NVWRQEI-VDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPATIPGDIIFIAADKPHPD 241
            .:.|:.: .|.:..|.|.:  .|.:.|..|...||:..|..|||..|.:||.||:||..||.||.
Human   180 KISRKRLNADGRSYRSEDK--ILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFIIKDKDHPK 242

  Fly   242 FERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVITDVVQPGYTKVVPLEGLPKCRNLDA 306
            | :|:..:::|...|.|.:|..|.:..:.|||.|.:.:.:.|:|:||..:.:...|||..:|.| 
Human   243 F-KRDGSNIIYTAKISLREALCGCSINVPTLDGRNIPMSVNDIVKPGMRRRIIGYGLPFPKNPD- 305

  Fly   307 VTAIKEANKKVEQFGDLIIEFDYIFPKYLTPHMKHITRE 345
                        |.|||:|||:..||..::...|.:.|:
Human   306 ------------QRGDLLIEFEVSFPDTISSSSKEVLRK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 105/364 (29%)
DnaJ 7..87 CDD:278647 23/79 (29%)
DnaJ_C 156..335 CDD:199909 62/188 (33%)
DNAJB4NP_001304028.1 DnaJ 1..332 CDD:223560 104/362 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.