DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and DNAJA2

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_005871.1 Gene:DNAJA2 / 10294 HGNCID:14884 Length:412 Species:Homo sapiens


Alignment Length:388 Identity:97/388 - (25%)
Similarity:155/388 - (39%) Gaps:97/388 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NRPELDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQ 66
            |..:...|.:|..|.||::.::..|||:||...  |.||.      |.|.:             :
Human     3 NVADTKLYDILGVPPGASENELKKAYRKLAKEY--HPDKN------PNAGD-------------K 46

  Fly    67 WAYVNMAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQYDGDHMKVYERVFGS------- 124
            :..::.|::||.|...|.:|||:||.||.||   ..|       .|....::..:||.       
Human    47 FKEISFAYEVLSNPEKRELYDRYGEQGLREG---SGG-------GGGMDDIFSHIFGGGLFGFMG 101

  Fly   125 --------------------------YSPYANVIDAISNPPSLYATRQHGI--GVRSKDASTERI 161
                                      |:.....:....|......:.|.|.  .|:...|...|.
Human   102 NQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRG 166

  Fly   162 IELSLEEVRTGCVKLMNV------WRQEIVDAKE-------SRLEKRKHTLKLNIAPGTTAGTRF 213
            :.:.:.::..|.|:.|..      ...|:::.|:       .::.|....|::::..|...|.|.
Human   167 VRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRI 231

  Fly   214 CFKEEGDRYPATIPGDIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLK 278
            .|..|.|:.|...||||:.:..:|.|..|: |:.:||.....|||.:|..||.|....||.||:.
Human   232 TFTGEADQAPGVEPGDIVLLLQEKEHEVFQ-RDGNDLHMTYKIGLVEALCGFQFTFKHLDGRQIV 295

  Fly   279 VVIT--DVVQPGYTKVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPK--YLTP 337
            |...  .|::||..:||..||:|:.||            ..|: |||.|:||..||:  ::.|
Human   296 VKYPPGKVIEPGCVRVVRGEGMPQYRN------------PFEK-GDLYIKFDVQFPENNWINP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 96/383 (25%)
DnaJ 7..87 CDD:278647 20/79 (25%)
DnaJ_C 156..335 CDD:199909 57/195 (29%)
DNAJA2NP_005871.1 PTZ00037 4..412 CDD:240236 96/387 (25%)
CXXCXGXG motif 143..150 0/6 (0%)
CXXCXGXG motif 159..166 1/6 (17%)
CXXCXGXG motif 186..193 0/6 (0%)
CXXCXGXG motif 202..209 0/6 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.880

Return to query results.
Submit another query.