DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and dnajb5

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_012821923.1 Gene:dnajb5 / 100487123 XenbaseID:XB-GENE-995211 Length:407 Species:Xenopus tropicalis


Alignment Length:381 Identity:108/381 - (28%)
Similarity:162/381 - (42%) Gaps:79/381 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCP--HRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAY 69
            |||.:|....||.:::|..|||::|::..|  ::|...|..|..:|:                  
 Frog    63 DYYKILGLASGANEDEIKKAYRKMALKYHPDKNKDANAEDKFKEIAE------------------ 109

  Fly    70 VNMAFDVLGNDLYRAIYDRFGEAGLFE--GVMLPNGYFPPYQYDGDHMKVYERVFGSYSPY---- 128
               |:|||.:...||:||::||.||..  |.....|....|.:.||....:...||..:|:    
 Frog   110 ---AYDVLSDPKKRAVYDQYGEEGLKTGGGSTGNTGSSFHYTFHGDPHATFASFFGGSNPFDIFF 171

  Fly   129 -------ANVID--------------------AISNPPSLYATRQHGIGVRSK--DASTERIIEL 164
                   :|..|                    ..|.....:...|..:..|.|  |......:::
 Frog   172 GSSRSRMSNGFDHEDMDINEDEDDLFGGFGRFGFSGVNGFHKRHQDQLHSRRKVQDPPVVHELKV 236

  Fly   165 SLEEVRTGCVKLMNVWRQEI-VDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPATIPG 228
            ||||:..||.|.|.:.|:.: .|.:..|.|.:  .|.:.|..|...||:..|.:|||.....||.
 Frog   237 SLEEIYHGCTKRMKITRRRLNPDGRTVRTEDK--ILNVVIKKGWKEGTKITFPKEGDATSENIPA 299

  Fly   229 DIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVITDVVQPGYTKVV 293
            ||:|:..||||..| :|:..::||...|.|.:|..|.|..|.|:|.|.:.:..:||::||..|.:
 Frog   300 DIVFLLKDKPHALF-KRDGSNIVYTAKITLKEALCGCTVNIPTIDGRVIPLPCSDVIKPGAVKRL 363

  Fly   294 PLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPKYLTPHMKHITREFFRE 349
            ..||||             ..|...|.||||:||...||    ..:...|||..::
 Frog   364 RGEGLP-------------FPKVPNQRGDLIVEFQVRFP----DRIPQPTRELLKQ 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 108/381 (28%)
DnaJ 7..87 CDD:278647 22/81 (27%)
DnaJ_C 156..335 CDD:199909 62/179 (35%)
dnajb5XP_012821923.1 DnaJ 60..402 CDD:223560 108/379 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.