DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc37 and CDC37L1

DIOPT Version :9

Sequence 1:NP_477006.1 Gene:Cdc37 / 38232 FlyBaseID:FBgn0011573 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_060383.2 Gene:CDC37L1 / 55664 HGNCID:17179 Length:337 Species:Homo sapiens


Alignment Length:271 Identity:83/271 - (30%)
Similarity:140/271 - (51%) Gaps:37/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RWRHQARVERMAEMD-HEKDELKKKRQSYQARLMDVKERISKKDGDEEALKKELEKIEAEGKELD 93
            :|......:::..:. |..:.|.::....|..:.::::|      :||..:||    ||      
Human    68 KWNLAEAQQKLGSLALHNSESLDQEHAKAQTAVSELRQR------EEEWRQKE----EA------ 116

  Fly    94 RIESEMIKKEKKTPWNVDTISKPGFEKTVINKKAGRKPDENLSEEEREQRMKQFVKENEKLCQQY 158
                 ::::||...|:.|.|||..|.|:.||:       :...:.|.|.:.:.|:::.|:..:.:
Human   117 -----LVQREKMCLWSTDAISKDVFNKSFINQ-------DKRKDTEDEDKSESFMQKYEQKIRHF 169

  Fly   159 GMLRKYDDSKRFLQEHLHLVGEETANYLVIWSINLEMEEKHELMAHVAHQCICMQYILELAKQLD 223
            |||.::|||:|||.:|.:||.||||.||::|..:||.|:|..||..:|||.:.||:|:|:||..:
Human   170 GMLSRWDDSQRFLSDHPYLVCEETAKYLILWCFHLEAEKKGALMEQIAHQAVVMQFIMEMAKNCN 234

  Fly   224 VDPRACVSSFFSKIQHCHPEYRAQFDSEIEGFKGRIQKRAQ-EKIQEAIAQAEEEERKERLGPGG 287
            ||||.|...||.|.:.....|...|.:|:|.||.|::..:| :..|....|       ..:...|
Human   235 VDPRGCFRLFFQKAKAEEEGYFEAFKNELEAFKSRVRLYSQSQSFQPMTVQ-------NHVPHSG 292

  Fly   288 LDPADVFESLP 298
            :....:.||||
Human   293 VGSIGLLESLP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc37NP_477006.1 CDC37_N 1..121 CDD:198139 19/91 (21%)
CDC37_M 130..266 CDD:215010 54/136 (40%)
CDC37_C 283..372 CDD:215009 5/16 (31%)
CDC37L1NP_060383.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
Self-association 2..171 26/130 (20%)
CDC37_N <71..139 CDD:296150 18/88 (20%)
CDC37_M 138..282 CDD:215010 58/150 (39%)
Self-association and interaction with Hsp90 147..277 54/129 (42%)
Interaction with Hsp70 267..337 10/44 (23%)
Required for interaction with STIP1 278..337 7/33 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159336
Domainoid 1 1.000 128 1.000 Domainoid score I5319
eggNOG 1 0.900 - - E1_KOG2260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D451416at33208
OrthoFinder 1 1.000 - - FOG0002158
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12800
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.