DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc37 and K07E8.6

DIOPT Version :9

Sequence 1:NP_477006.1 Gene:Cdc37 / 38232 FlyBaseID:FBgn0011573 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001254017.1 Gene:K07E8.6 / 187114 WormBaseID:WBGene00019497 Length:339 Species:Caenorhabditis elegans


Alignment Length:260 Identity:64/260 - (24%)
Similarity:107/260 - (41%) Gaps:57/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SKKDGDEEALKKELEKIEAEGKELDRIESEMIKKEK-------KTPWNVDTISKPGFEKTVINKK 126
            :||...:|...:||.:...|.......|:.|.:.::       :||   :.:.|...:...:|:.
 Worm    11 NKKKAQKEPSAQELWETFPEALRRAIQENSMTQFDEAVKNVFTETP---EILRKQCIQAGFLNEG 72

  Fly   127 AGRKPDENLS--EEEREQRMKQFVKENEKLCQQYGMLRKYDDSKRFLQEHLHLVGEETANYLVIW 189
            .|     |.|  |:.:.|.|....:.|..|.:|...|:  ..::.||.||.|:..|.|.|:|.|.
 Worm    73 TG-----NFSTLEDIKSQDMLSHFETNSALLEQLSELQ--GSTEPFLTEHPHMAAEHTVNWLTIA 130

  Fly   190 SINLEMEEKHELMAHVAHQCICMQYILELA---KQLDVDPRACVSSFFSKIQHCHPEYRAQFDSE 251
            :::..:::..|.:|.::.:|:..|..|..|   ||           ||.|.     |.....| |
 Worm   131 ALSSAIDKNEEKLAALSEKCVVFQLFLASATGQKQ-----------FFKKF-----EVSENLD-E 178

  Fly   252 IEGFKGRIQKRAQEKIQEAIAQAEEEERKERLGPGGLDPADVFESLPDELKACFESRDVELLQKT 316
            ::.||.|::.|||.|        .|:..|..|..|.:|.....|.|          :.:|.|:||
 Worm   179 VKAFKSRMRSRAQAK--------GEKPEKINLNQGTVDSRQFLEEL----------KQLENLKKT 225

  Fly   317  316
             Worm   226  225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc37NP_477006.1 CDC37_N 1..121 CDD:198139 11/58 (19%)
CDC37_M 130..266 CDD:215010 39/140 (28%)
CDC37_C 283..372 CDD:215009 9/34 (26%)
K07E8.6NP_001254017.1 CDC37_M 78..197 CDD:384899 39/145 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166949
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D451416at33208
OrthoFinder 1 1.000 - - FOG0002158
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12800
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.