DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Spec and Dyb

DIOPT Version :9

Sequence 1:NP_001261286.1 Gene:alpha-Spec / 38231 FlyBaseID:FBgn0250789 Length:2457 Species:Drosophila melanogaster
Sequence 2:NP_001097287.1 Gene:Dyb / 36362 FlyBaseID:FBgn0033739 Length:816 Species:Drosophila melanogaster


Alignment Length:527 Identity:99/527 - (18%)
Similarity:162/527 - (30%) Gaps:215/527 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly  1060 ALARERQNKLNETVKAYVLVREAADLAQWIRDKENHAQIADVVGEDLEEVEVLQKKFDDFNDDLK 1124
            |.|.:.:::|        :.|.||.|||..|...|....|..:|.|                   
  Fly   393 ASANDEEHRL--------IARYAARLAQENRAPSNLPDNATPIGTD------------------- 430

  Fly  1125 ANEVRLANMNEIAVQLTSLGQTEAALKIQTQMQDLNEKWNNLQTLTAEKASQLGSAHEVQRFHRD 1189
                            .|..|.|...:::::.:::                    ..|:.|..|.
  Fly   431 ----------------NSRAQRELIAQLESKNKEI--------------------MREIARLRRQ 459

  Fly  1190 IDETKDWIAEKANALNNDDLGKDLRSVQTLQRKHEGVERDLAALRDKIRQLDETANRLM------ 1248
             .||:....|....:|      :||:::  |||.| :|..|.||:|..|||.|....||      
  Fly   460 -QETEQMAPENPALIN------ELRALR--QRKGE-LEGHLGALQDSRRQLMEQLEGLMRMLKNQ 514

  Fly  1249 -----QSHPDTAEQT---------------------YAKQKEINEMWDQIITKSTARKEKLLDSY 1287
                 :|.|:::.::                     :|:|.:.:.|...:    .|.:::||...
  Fly   515 QTASPRSTPNSSPRSGKSPPMPGGAGILGTSPMSALHAQQMQQHPMAGGV----RASQQQLLQQQ 575

  Fly  1288 DLQR-----FLSDYRDLLAWINSMMSLVTSDELANDVTGAEALIERHQARRAEIGFTLGISSAP- 1346
            ..|.     |            |...|...:::::|:..|               |....|:.| 
  Fly   576 QQQAHGHGPF------------SQSQLEQLNQISSDMRSA---------------FAANGSATPP 613

  Fly  1347 -----GAAASTSSIAS--PSGDEEHRTEIDARAGTFGAFEQFGNELLQANHYASPEIKEKIEDLA 1404
                 .|.|:.|:|.|  |..::......||             ||.:|..:.:..|...:.||.
  Fly   614 PMRTTTATANVSAIPSLNPISNQNPNLNPDA-------------ELNEAADHLTSAISHMVSDLN 665

  Fly  1405 KAR-------------------------EDLEKAWTERRLQLEQNLDLQLYMRDCELAESWMSAR 1444
            ..|                         ..:|...:|...|.|.|        |||..|     .
  Fly   666 AGRGRAQQLGPQPASSIPQARFIMPLEFRHIEGGESEDSSQCECN--------DCECGE-----Y 717

  Fly  1445 EAFLNADDD------ANAGGNVEAL-----IKKHEDFDKAINGHEQKIAALQTVADQLIAQNHYA 1498
            |.....|:|      |...||..:|     :.:.:.||......|:    |..|...|..:||..
  Fly   718 EEVFRTDEDLECEGAAAPFGNAYSLFPTSGVHEEDHFDYTFGQGEE----LSQVNRILGYRNHPE 778

  Fly  1499 SNLVDEK 1505
            ..:.||:
  Fly   779 LFIDDEQ 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-SpecNP_001261286.1 SH3_Alpha_Spectrin 974..1026 CDD:212742
SPEC 1074..1287 CDD:238103 46/244 (19%)
SPEC 1182..1425 CDD:238103 60/312 (19%)
SPEC 1426..1638 CDD:238103 21/91 (23%)
SPEC 1533..1744 CDD:238103
SPEC 1646..1850 CDD:238103
SPEC 1852..2062 CDD:238103
SPEC 1958..2176 CDD:238103
SPEC 2072..2296 CDD:238103
EFh 2311..2379 CDD:238008
EFhand_Ca_insen 2386..2456 CDD:400872
SPEC 48..258 CDD:238103
SPEC 154..364 CDD:238103
SPEC 261..470 CDD:238103
SPEC 471..680 CDD:238103
SPEC 682..893 CDD:238103
Spectrin 893..>961 CDD:395348
DybNP_001097287.1 EF-hand_2 7..131 CDD:286194
EF-hand_3 135..223 CDD:286195
ZZ_dystrophin 232..280 CDD:239074
Ribosomal_L29 436..482 CDD:279204 10/74 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.