DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment alpha-Spec and LOC110440135

DIOPT Version :9

Sequence 1:	NP_001261286.1	Gene:	alpha-Spec / 38231	FlyBaseID:	FBgn0250789	Length:	2457	Species:	Drosophila melanogaster
Sequence 2:	XP_021335869.1	Gene:	LOC110440135 / 110440135	-ID:	-	Length:	137	Species:	Danio rerio

Alignment Length:	133	Identity:	48/133 - (36%)
Similarity:	76/133 - (57%)	Gaps:	12/133 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly  2323 KSGKLNHQEFKSCLRALGYDLPMVEEGQPDPEFEAILDVVDPNRDGYVSLQEYIAFMISKETENV 2387
            |.|.:...:|::||.::||||       .:.||..|:.:||||..|.|:.|.::.|| ::||...
Zfish    12 KKGGMETDDFRACLISMGYDL-------GEAEFARIMALVDPNGSGVVTFQAFVDFM-TRETGES 68

  Fly  2388 QSYEEIENAFRAITAADRPYVTKEELYCNLTKDMADYCVQRMKPFSEPRSGQPIKDALDYIDFTR 2452
            .:.|::..:|| |.|||:||:..:||...|..:.|:||:.||.|:..|   ..:..||||..|:.
Zfish    69 DTSEQVVASFR-ILAADKPYILVDELRRELPPEQAEYCISRMPPYKGP---DAVPGALDYAAFST 129

  Fly  2453 TLF 2455
            .|:
Zfish   130 ALY 132

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
alpha-Spec	NP_001261286.1	SH3_Alpha_Spectrin	974..1026	CDD:212742
		SPEC	1074..1287	CDD:238103
		SPEC	1182..1425	CDD:238103
		SPEC	1426..1638	CDD:238103
		SPEC	1533..1744	CDD:238103
		SPEC	1646..1850	CDD:238103
		SPEC	1852..2062	CDD:238103
		SPEC	1958..2176	CDD:238103
		SPEC	2072..2296	CDD:238103
		EFh	2311..2379	CDD:238008	19/55 (35%)
		EFhand_Ca_insen	2386..2456	CDD:400872	25/70 (36%)
		SPEC	48..258	CDD:238103
		SPEC	154..364	CDD:238103
		SPEC	261..470	CDD:238103
		SPEC	471..680	CDD:238103
		SPEC	682..893	CDD:238103
		Spectrin	893..>961	CDD:395348
LOC110440135	XP_021335869.1	EFh	<14..62	CDD:238008	20/55 (36%)
LOC110440135	XP_021335869.1	EFhand_Ca_insen	67..133	CDD:312305	25/70 (36%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D543832at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010