DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2021 and MAK31

DIOPT Version :9

Sequence 1:NP_647660.1 Gene:CG2021 / 38229 FlyBaseID:FBgn0035271 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_009948.1 Gene:MAK31 / 850383 SGDID:S000000614 Length:88 Species:Saccharomyces cerevisiae


Alignment Length:88 Identity:21/88 - (23%)
Similarity:44/88 - (50%) Gaps:12/88 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHERVFSTTSGIEQIVLGLHIIRGDNIAV 68
            |..:|.:|:.:...:.|..:|:|...|..:|:::|...||:.|::.     ::||..:...::..
Yeast     6 LSDFIGNTLIVSLTEDRILVGSLVAVDAQMNLLLDHVEERMGSSSR-----MMGLVSVPRRSVKT 65

  Fly    69 IGLIDETIDSRLD------LANI 85
            | :||:.:...|.      :|||
Yeast    66 I-MIDKPVLQELTANKVELMANI 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2021NP_647660.1 LSm8 1..91 CDD:212474 21/88 (24%)
MAK31NP_009948.1 LSMD1 3..69 CDD:212486 15/68 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15588
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.