DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2021 and LSM3B

DIOPT Version :9

Sequence 1:NP_647660.1 Gene:CG2021 / 38229 FlyBaseID:FBgn0035271 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_177812.1 Gene:LSM3B / 844021 AraportID:AT1G76860 Length:98 Species:Arabidopsis thaliana


Alignment Length:94 Identity:22/94 - (23%)
Similarity:40/94 - (42%) Gaps:29/94 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSG-LESYINHTVSII--TADGRNFI---------GTLKGFDQTINIII-------------DEC 40
            ||| .|:.:...:.:|  :.|.|.::         |.|..|||.:|:|:             ||.
plant     1 MSGEEEATVREPLDLIRLSLDERIYVKLRSDRELRGKLHAFDQHLNMILGDVEETITTVEIDDET 65

  Fly    41 HERVFSTTSGIEQIVLGLHIIRGDNIAVI 69
            :|.:..||....:.:    .:|||.:.::
plant    66 YEEIVRTTKRTIEFL----FVRGDGVILV 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2021NP_647660.1 LSm8 1..91 CDD:212474 22/94 (23%)
LSM3BNP_177812.1 LSm3 11..92 CDD:212477 18/84 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.