DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2021 and LSM8

DIOPT Version :10

Sequence 1:NP_647660.1 Gene:CG2021 / 38229 FlyBaseID:FBgn0035271 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001185323.1 Gene:LSM8 / 842881 AraportID:AT1G65700 Length:141 Species:Arabidopsis thaliana


Alignment Length:137 Identity:59/137 - (43%)
Similarity:75/137 - (54%) Gaps:43/137 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGLESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHERVFST------------------- 47
            :|||:.::..:|:||.||||.:|.||||||..|||:||.|||||||                   
plant     5 TGLETLVDQIISVITNDGRNIVGVLKGFDQATNIILDESHERVFSTKCHLFNRILRKLTQIFKIG 69

  Fly    48 --------------TS----------GIEQIVLGLHIIRGDNIAVIGLIDETIDSRLDLANIRGE 88
                          ||          |::|.||||:|||||||.|||.:||.:|:.||.:.:|..
plant    70 LVLQFFVCMSGHVDTSLDKCSWIFLEGVQQHVLGLYIIRGDNIGVIGELDEELDASLDFSKLRAH 134

  Fly    89 PLGPVVH 95
            ||.||||
plant   135 PLKPVVH 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2021NP_647660.1 LSm8 1..91 CDD:212474 54/131 (41%)
LSM8NP_001185323.1 LSm8 7..137 CDD:212474 53/129 (41%)

Return to query results.
Submit another query.