DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2021 and LSM8

DIOPT Version :9

Sequence 1:NP_647660.1 Gene:CG2021 / 38229 FlyBaseID:FBgn0035271 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001185323.1 Gene:LSM8 / 842881 AraportID:AT1G65700 Length:141 Species:Arabidopsis thaliana


Alignment Length:137 Identity:59/137 - (43%)
Similarity:75/137 - (54%) Gaps:43/137 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGLESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHERVFST------------------- 47
            :|||:.::..:|:||.||||.:|.||||||..|||:||.|||||||                   
plant     5 TGLETLVDQIISVITNDGRNIVGVLKGFDQATNIILDESHERVFSTKCHLFNRILRKLTQIFKIG 69

  Fly    48 --------------TS----------GIEQIVLGLHIIRGDNIAVIGLIDETIDSRLDLANIRGE 88
                          ||          |::|.||||:|||||||.|||.:||.:|:.||.:.:|..
plant    70 LVLQFFVCMSGHVDTSLDKCSWIFLEGVQQHVLGLYIIRGDNIGVIGELDEELDASLDFSKLRAH 134

  Fly    89 PLGPVVH 95
            ||.||||
plant   135 PLKPVVH 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2021NP_647660.1 LSm8 1..91 CDD:212474 54/131 (41%)
LSM8NP_001185323.1 LSm8 7..137 CDD:212474 53/129 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 96 1.000 Domainoid score I2470
eggNOG 1 0.900 - - E1_KOG1784
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9419
Inparanoid 1 1.050 124 1.000 Inparanoid score I1945
OMA 1 1.010 - - QHG54662
OrthoDB 1 1.010 - - D1545004at2759
OrthoFinder 1 1.000 - - FOG0005238
OrthoInspector 1 1.000 - - oto4158
orthoMCL 1 0.900 - - OOG6_102771
Panther 1 1.100 - - LDO PTHR15588
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4250
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.