powered by:
Protein Alignment CG2021 and LSM1A
DIOPT Version :9
Sequence 1: | NP_647660.1 |
Gene: | CG2021 / 38229 |
FlyBaseID: | FBgn0035271 |
Length: | 95 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_564072.1 |
Gene: | LSM1A / 838495 |
AraportID: | AT1G19120 |
Length: | 128 |
Species: | Arabidopsis thaliana |
Alignment Length: | 72 |
Identity: | 27/72 - (37%) |
Similarity: | 46/72 - (63%) |
Gaps: | 1/72 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 SGLESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHERVFSTTSGIEQIVLGLHIIRGDNI 66
:.|.:|::..:.::..|||..:|.|:.|||..|.:::|.:|||.......: |.|||:||||:|:
plant 13 TSLAAYLDKKLLVLLRDGRKLMGLLRSFDQFANAVLEEAYERVIVGDLYCD-IPLGLYIIRGENV 76
Fly 67 AVIGLID 73
.:||.:|
plant 77 VLIGELD 83
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2021 | NP_647660.1 |
LSm8 |
1..91 |
CDD:212474 |
27/72 (38%) |
LSM1A | NP_564072.1 |
LSm1 |
9..82 |
CDD:212475 |
26/69 (38%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.