DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2021 and SAD1

DIOPT Version :10

Sequence 1:NP_647660.1 Gene:CG2021 / 38229 FlyBaseID:FBgn0035271 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_199698.1 Gene:SAD1 / 834945 AraportID:AT5G48870 Length:88 Species:Arabidopsis thaliana


Alignment Length:66 Identity:17/66 - (25%)
Similarity:34/66 - (51%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHERVFSTTSGIEQIVLGLHIIRGDNIAV 68
            ::..|...:.:|....:..:|.|||||..:|:::::..|... |..|.....|...::.|:|||:
plant    14 IDRCIGSKIWVIMKGDKELVGILKGFDVYVNMVLEDVTEYEI-TAEGRRVTKLDQILLNGNNIAI 77

  Fly    69 I 69
            :
plant    78 L 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2021NP_647660.1 LSm8 1..91 CDD:212474 17/66 (26%)
SAD1NP_199698.1 LSm5 7..82 CDD:212479 17/66 (26%)

Return to query results.
Submit another query.