DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2021 and LSM1B

DIOPT Version :10

Sequence 1:NP_647660.1 Gene:CG2021 / 38229 FlyBaseID:FBgn0035271 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_566476.1 Gene:LSM1B / 820624 AraportID:AT3G14080 Length:128 Species:Arabidopsis thaliana


Alignment Length:75 Identity:29/75 - (38%)
Similarity:46/75 - (61%) Gaps:7/75 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGLESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHERVFSTTSGIEQ---IVLGLHIIRG 63
            :.|.||::..:.::..|||..:|||:.|||..|.:::...|||...    ||   |.|||::|||
plant    13 TSLASYLDRKLLVLLRDGRKLMGTLRSFDQFANAVLEGACERVIVG----EQYCDIPLGLYVIRG 73

  Fly    64 DNIAVIGLID 73
            :|:.:||.:|
plant    74 ENVVLIGELD 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2021NP_647660.1 LSm8 1..91 CDD:212474 29/75 (39%)
LSM1BNP_566476.1 LSm1 12..82 CDD:212475 28/72 (39%)

Return to query results.
Submit another query.