DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2021 and SNRPG

DIOPT Version :10

Sequence 1:NP_647660.1 Gene:CG2021 / 38229 FlyBaseID:FBgn0035271 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001304094.1 Gene:SNRPG / 6637 HGNCID:11163 Length:96 Species:Homo sapiens


Alignment Length:63 Identity:23/63 - (36%)
Similarity:37/63 - (58%) Gaps:8/63 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHERVFSTTSGIEQIVLGLHIIRGDNI 66
            |:.:::..:|:....||:..|.|:|||..:|::||||.|   ..||| :|..:|:    .|||
Human     9 LKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVE---MATSG-QQNNIGM----VDNI 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2021NP_647660.1 LSm8 1..91 CDD:212474 23/63 (37%)
SNRPGNP_001304094.1 Sm_G 5..>60 CDD:212466 20/58 (34%)

Return to query results.
Submit another query.