powered by:
Protein Alignment CG2021 and Lsm7
DIOPT Version :9
Sequence 1: | NP_647660.1 |
Gene: | CG2021 / 38229 |
FlyBaseID: | FBgn0035271 |
Length: | 95 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006241020.1 |
Gene: | Lsm7 / 362829 |
RGDID: | 1305354 |
Length: | 109 |
Species: | Rattus norvegicus |
Alignment Length: | 72 |
Identity: | 23/72 - (31%) |
Similarity: | 36/72 - (50%) |
Gaps: | 8/72 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHERV------FSTTSGIEQIVLGLHIIR 62
|..||:.|:.:....||...|.|||||..:|:::|...|.: :..|....| |||.:.|
Rat 21 LSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQ--LGLVVCR 83
Fly 63 GDNIAVI 69
|.::.:|
Rat 84 GTSVVLI 90
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2021 | NP_647660.1 |
LSm8 |
1..91 |
CDD:212474 |
23/72 (32%) |
Lsm7 | XP_006241020.1 |
LSm7 |
17..103 |
CDD:212476 |
23/72 (32%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.