DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2021 and lsm8

DIOPT Version :9

Sequence 1:NP_647660.1 Gene:CG2021 / 38229 FlyBaseID:FBgn0035271 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_588509.1 Gene:lsm8 / 2539322 PomBaseID:SPCC1840.10 Length:94 Species:Schizosaccharomyces pombe


Alignment Length:92 Identity:39/92 - (42%)
Similarity:63/92 - (68%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHERVFSTTSGIEQIVLGLHIIRGDNIAV 68
            |..::...|.:||.|||..:|:|||||.|.|:|:.:..||:.|....:|.|.||::::||:|:|:
pombe     3 LADFMEQRVQVITNDGRVVLGSLKGFDHTTNLILSDSFERIISMDQDMETIPLGVYLLRGENVAM 67

  Fly    69 IGLIDETIDSRLDLANIRGEPLGPVVH 95
            :||::|.:||.::...||||.:..|||
pombe    68 VGLVNEELDSEIEWTKIRGEAIPDVVH 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2021NP_647660.1 LSm8 1..91 CDD:212474 36/86 (42%)
lsm8NP_588509.1 LSm8 2..90 CDD:212474 36/86 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I2767
eggNOG 1 0.900 - - E1_KOG1784
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I1754
OMA 1 1.010 - - QHG54662
OrthoFinder 1 1.000 - - FOG0005238
OrthoInspector 1 1.000 - - oto100707
orthoMCL 1 0.900 - - OOG6_102771
Panther 1 1.100 - - LDO PTHR15588
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R671
SonicParanoid 1 1.000 - - X4250
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.