DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2021 and lsm-8

DIOPT Version :9

Sequence 1:NP_647660.1 Gene:CG2021 / 38229 FlyBaseID:FBgn0035271 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_500964.1 Gene:lsm-8 / 177393 WormBaseID:WBGene00003082 Length:98 Species:Caenorhabditis elegans


Alignment Length:92 Identity:47/92 - (51%)
Similarity:69/92 - (75%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGLESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHERVFSTTSGIEQIVLGLHIIRGDNI 66
            |.|::|:|..|:::|.|||..:|.||||||.||::|::.|||.:|.|.|:....|||:||||:|:
 Worm     3 STLDAYMNRMVNVVTGDGRVIVGLLKGFDQLINLVIEDAHERSYSETEGVLTTPLGLYIIRGENV 67

  Fly    67 AVIGLIDETIDSRLDLANIRGEPLGPV 93
            |:||.|||.:|.|:||.|::..||.|:
 Worm    68 AIIGEIDEELDKRVDLENVKAAPLAPI 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2021NP_647660.1 LSm8 1..91 CDD:212474 45/88 (51%)
lsm-8NP_500964.1 LSm8 3..91 CDD:212474 44/87 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159396
Domainoid 1 1.000 83 1.000 Domainoid score I5352
eggNOG 1 0.900 - - E1_KOG1784
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9419
Inparanoid 1 1.050 109 1.000 Inparanoid score I3468
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54662
OrthoDB 1 1.010 - - D1545004at2759
OrthoFinder 1 1.000 - - FOG0005238
OrthoInspector 1 1.000 - - oto20703
orthoMCL 1 0.900 - - OOG6_102771
Panther 1 1.100 - - LDO PTHR15588
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R671
SonicParanoid 1 1.000 - - X4250
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.