DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2021 and lsm8

DIOPT Version :9

Sequence 1:NP_647660.1 Gene:CG2021 / 38229 FlyBaseID:FBgn0035271 Length:95 Species:Drosophila melanogaster
Sequence 2:XP_002935003.2 Gene:lsm8 / 100486227 XenbaseID:XB-GENE-986008 Length:96 Species:Xenopus tropicalis


Alignment Length:94 Identity:65/94 - (69%)
Similarity:80/94 - (85%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGLESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHERVFSTTSGIEQIVLGLHIIRGDNI 66
            |.||:|||.||::||:|||..:|||||||||||:|:||.||||||::.|:||:||||:|:||||:
 Frog     3 SALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNV 67

  Fly    67 AVIGLIDETIDSRLDLANIRGEPLGPVVH 95
            ||||.|||..||.|||.|||.|||..||:
 Frog    68 AVIGEIDEETDSALDLGNIRAEPLNSVVN 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2021NP_647660.1 LSm8 1..91 CDD:212474 62/88 (70%)
lsm8XP_002935003.2 LSm8 2..92 CDD:212474 62/88 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6306
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9419
Inparanoid 1 1.050 138 1.000 Inparanoid score I4418
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545004at2759
OrthoFinder 1 1.000 - - FOG0005238
OrthoInspector 1 1.000 - - oto102733
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R671
SonicParanoid 1 1.000 - - X4250
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.