DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8001 and Dcaf6

DIOPT Version :9

Sequence 1:NP_001261283.1 Gene:CG8001 / 38224 FlyBaseID:FBgn0035268 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_036009808.1 Gene:Dcaf6 / 74106 MGIID:1921356 Length:968 Species:Mus musculus


Alignment Length:263 Identity:84/263 - (31%)
Similarity:128/263 - (48%) Gaps:29/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 YYGSRQVVEQMTLLSSLNVHHGCVNSLNFNRAGDLICSGSDDLTIVVWDWAKEKQLHRFRSGHNM 370
            |.|.|:.::::.|.::||||.||||::.:|..|:.|.|||||..:|:.:....|.|...||||..
Mouse    31 YLGRREFIQRLKLEATLNVHDGCVNTICWNDTGEYILSGSDDTKLVISNPYSRKVLTTIRSGHRA 95

  Fly   371 NIFQTKFIDSAGCLDIVSSSRDGQVRRSVIPPSGGVIKPIRLYTHSESVHKIIVVPHSRHELMSA 435
            |||..||:.......|||.|.||.:..:.|.......:..:...|..:.::|:.||:..:..:|.
Mouse    96 NIFSAKFLPCTDDKQIVSCSGDGVIFYTNIEQDAETNRQCQFTCHYGTTYEIMTVPNDPYTFLSC 160

  Fly   436 GEDAAVKHFDLRASNAAT-------TMMRCVYNDENERGRVRLFSIAHHPYAPEFCVSG-SDDIL 492
            |||..|:.||.|...:.|       .::.|         |....|:|..|..|.:...| ||..:
Mouse   161 GEDGTVRWFDTRIKTSCTKEDCKDDILINC---------RRAATSVAICPPVPYYLAVGCSDSSV 216

  Fly   493 RVYDKRNL-AKAIHQMAPR-------NLLEAQITQITCAV----YNHSGSEILASYSDAGIYLFD 545
            |:||:|.| .:|....|.|       ..:.:.::..:|.|    |:..|.|||.|||...|||||
Mouse   217 RIYDRRMLGTRATGNYAGRGTTGMVARFIPSHLSNKSCRVTSLCYSEDGQEILVSYSSDYIYLFD 281

  Fly   546 SRN 548
            .::
Mouse   282 PKD 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8001NP_001261283.1 WD40 <317..653 CDD:225201 81/252 (32%)
WD40 318..635 CDD:295369 81/251 (32%)
WD40 repeat 331..367 CDD:293791 12/35 (34%)
WD40 repeat 373..414 CDD:293791 10/40 (25%)
WD40 repeat 419..462 CDD:293791 13/49 (27%)
WD40 repeat 472..513 CDD:293791 15/49 (31%)
WD40 repeat 520..559 CDD:293791 15/33 (45%)
WD40 repeat 567..594 CDD:293791
WD40 repeat 611..657 CDD:293791
Dcaf6XP_036009808.1 WD40 43..>292 CDD:421866 81/251 (32%)
WD40 repeat 55..92 CDD:293791 13/36 (36%)
WD40 repeat 97..138 CDD:293791 11/40 (28%)
WD40 repeat 148..181 CDD:293791 11/32 (34%)
WD40 repeat 188..233 CDD:293791 15/53 (28%)
WD40 repeat 256..282 CDD:293791 13/25 (52%)
WD40 <838..897 CDD:421866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1334
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.