DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and Chi3l1

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001296749.1 Gene:Chi3l1 / 89824 RGDID:620874 Length:391 Species:Rattus norvegicus


Alignment Length:455 Identity:158/455 - (34%)
Similarity:230/455 - (50%) Gaps:95/455 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTLRSRLSGEAPQLWLLLLLASTASSLWASVAARTGPLHDKVVVCYVSTWAVYRPEQGAYAIENF 65
            |.:|..|:|.|.   |:||.:.:|..|                |||.:.|:.||...|:...:..
  Rat     9 MGMRVALTGFAV---LMLLQSCSAYKL----------------VCYYTNWSQYREGNGSCFPDAL 54

  Fly    66 DPNLCTHVVYAFAGLDITQAAIKSLDPWQDLKEEYGKGGYEKMTGLKRSHPHLKVSLAIGGWNEG 130
            |.:||||::|:||.:...:.   |...|.|:..      |..:..||..:|.||..|::|||:.|
  Rat    55 DHSLCTHIIYSFANISNNKL---STSEWNDVTL------YGMLNTLKTRNPRLKTLLSVGGWSFG 110

  Fly   131 SANYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKPADRENFVLLTKELREEFD 195
            |..:|.:|:|...|..||:.|:.|:|.|.||||||.|.||     .|.|:::|..|.|||:.||.
  Rat   111 SERFSRIVSNAKSRKTFVQSVAPFLRTYGFDGLDLAWLYP-----GPKDKQHFTTLIKELKAEFT 170

  Fly   196 E------HGLLLTSAIGASKKVIDEAYDVRQISRYLDYLHIMCYDYHGSWDRRVGYNAPL----- 249
            :      ..|||::|:.|.|..:|..|||.||:::||::::|.||:||:|....|:::||     
  Rat   171 KEVQPGTEKLLLSAAVSAGKVTLDSGYDVAQIAQHLDFINLMTYDFHGTWRHTTGHHSPLFRGQQ 235

  Fly   250 -TAPADDPLSVKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTLASGFLNDVS---EGVGFKGPYTR 310
             |.| |...:|.:.:.|:|:||||..|||||:|.:|::| ||||. .|.|.   .|.|..|.||:
  Rat   236 DTGP-DRFSNVDYGVGYMLRLGAPTNKLVMGIPTFGKSF-TLASS-ENQVGAPITGSGLPGRYTK 297

  Fly   311 EDGFLGYNEICQTLSNQTSGWTREWDPQTSQVLAKSERNVFTQEINVVT-------YDSSRSIAN 368
            |.|.|.|.|||..|..                 |:..| :..|::...|       ||...|:.|
  Rat   298 EKGTLAYYEICDFLRG-----------------AEVHR-ILGQQVPFATKGNQWVGYDDPESVKN 344

  Fly   369 KVLFAMSKRLAGVMVWSVDTDDFLGN-CKLDEDTYEDFQKVTAAPKRSSQNYPLLRTINEATMLA 432
            ||.:..:|:|||.|||:||.|||.|: |                  ..:.::||...|.||..:|
  Rat   345 KVKYLKNKQLAGAMVWAVDLDDFRGSFC------------------GHNVHFPLTNAIKEALAVA 391

  Fly   433  432
              Rat   392  391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 137/368 (37%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 145/407 (36%)
Chi3l1NP_001296749.1 Glyco_18 31..365 CDD:214753 138/384 (36%)
GH18_chitolectin_chitotriosidase 32..388 CDD:119351 147/424 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.