DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and ChiC

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001319999.1 Gene:ChiC / 827725 AraportID:AT4G19810 Length:379 Species:Arabidopsis thaliana


Alignment Length:378 Identity:98/378 - (25%)
Similarity:158/378 - (41%) Gaps:59/378 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 YAIENFDPNLCTHVVYAFAGLD--ITQAAIKSLDPWQDLKEEYGKGGYEKMT-GLKRSHPHLKVS 121
            :.:.:.|.:|.||:..|||.|:  ..|..:.|.:          :..:...| .::|.:|.:|..
plant    39 FPVTDIDSSLFTHLFCAFADLNSQTNQVTVSSAN----------QPKFSTFTQTVQRRNPSVKTL 93

  Fly   122 LAIGGWNEGSANYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKPADRENFVLL 186
            |:|||.......|:::.:|...|..|:.......|.|.|.|||||||||:    ...:..||..|
plant    94 LSIGGGIADKTAYASMASNPTSRKSFIDSSIRVARSYGFHGLDLDWEYPS----SATEMTNFGTL 154

  Fly   187 TKELRE----EFDEHG---LLLTSAIGASKKVIDEAYDVRQISRYLDYLHIMCYDYHG-SWDRRV 243
            .:|.|.    |....|   |||.:|:..|.......|.|..::..||::::|.||::| .|.|..
plant   155 LREWRSAVVAEASSSGKPRLLLAAAVFYSNNYYSVLYPVSAVASSLDWVNLMAYDFYGPGWSRVT 219

  Fly   244 GYNAPLTAPADDPLSVKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTLASGFLNDVSEGVGFKGPY 308
            |..|.|..|::...|........::.|.|.:|.|:|.|:||..::...:   |..|......|..
plant   220 GPPAALFDPSNAGPSGDAGTRSWIQAGLPAKKAVLGFPYYGYAWRLTNA---NSHSYYAPTTGAA 281

  Fly   309 TREDGFLGYNEICQTLSNQTSGWTREWDPQTSQVLAKSERNVFTQEI---------NVVTYDSSR 364
            ...||.:||.:|            |::      ::......|:...:         |.:.||.::
plant   282 ISPDGSIGYGQI------------RKF------IVDNGATTVYNSTVVGDYCYAGTNWIGYDDNQ 328

  Fly   365 SIANKVLFAMSKRLAGVMVWSVDTDDFLGNCKLDEDTYEDFQKVTAAPKRSSQ 417
            ||..||.:|..:.|.|...|.|..||..|..:.....::    .|.|..|:.|
plant   329 SIVTKVRYAKQRGLLGYFSWHVGADDNSGLSRAASQAWD----ATTATTRTIQ 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 91/348 (26%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 98/378 (26%)
ChiCNP_001319999.1 GH18_plant_chitinase_class_V 25..359 CDD:119358 94/354 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.