DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and AT4G19770

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_193712.2 Gene:AT4G19770 / 827721 AraportID:AT4G19770 Length:261 Species:Arabidopsis thaliana


Alignment Length:274 Identity:85/274 - (31%)
Similarity:114/274 - (41%) Gaps:63/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 RGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKPADRENFVLLTKELR-----EEFDEH--GLLL 201
            |..|:....|..|.|.|||||||||||.    ..|:..:|..|.||.|     |.:...  .|:|
plant     8 RKSFILSTISIARSYGFDGLDLDWEYPR----NAAEMSDFAELLKEWRYAVQGEAYSSELPVLIL 68

  Fly   202 TSAIGASKKVIDEAYDVRQISRYLDYLHIMCYDYHGSWDRRV-GYNAPLTAPADDP---LSVKFS 262
            |:.:..|.......|.|:.||..||:::|..||::|.....| |..|.|...:|.|   ..||..
plant    69 TATVYYSSNYNGVVYPVKFISELLDWVNIKAYDFYGPGCTEVTGPPAALYLQSDGPSGDSGVKDW 133

  Fly   263 IDYLLKLGAPPEKLVMGLPFYGRTFKTLAS----GFLNDVSEGVGFKGPYTREDGFLGYNEICQT 323
            ||    .|.|.||.|:|.|:||..: |||.    |:..|.:      ||...:||.:.|:::   
plant   134 ID----AGLPAEKAVLGFPYYGWAW-TLADPKNHGYYVDTT------GPAISDDGEISYSQL--- 184

  Fly   324 LSNQTSGWTREWDPQTSQVLAKSERNVFTQEINVVT------------YDSSRSIANKVLFAMSK 376
                     :.|         ..:....|...|:|.            |||..||..||::|..|
plant   185 ---------KTW---------IVDNKATTVHDNIVIGDYCYAGTTWIGYDSEESIVTKVIYAKQK 231

  Fly   377 RLAGVMVWSVDTDD 390
            .|.|...|.|..||
plant   232 GLLGYFSWQVGGDD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 83/271 (31%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 85/274 (31%)
AT4G19770NP_193712.2 GH18_chitinase-like <1..250 CDD:299167 85/274 (31%)
Glyco_18 <1..244 CDD:214753 83/271 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.