DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and AT4G19750

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_193710.2 Gene:AT4G19750 / 827719 AraportID:AT4G19750 Length:362 Species:Arabidopsis thaliana


Alignment Length:369 Identity:106/369 - (28%)
Similarity:155/369 - (42%) Gaps:57/369 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 STWAVYRPEQGAYAIENFDPNLCTHVVYAFAGLD-----ITQAAIKSLDPWQDLKEEYGKGGYEK 107
            |.|.| :||.. :...|.|....||:..|||.:|     :|.:|..|..             ...
plant    17 SYWVV-KPEND-FPAGNIDSTRFTHLFCAFADVDSSTHEVTISAANSCQ-------------VSS 66

  Fly   108 MT-GLKRSHPHLKVSLAIGGWNEGSANYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPT 171
            .| .:|..:..::..|:|||.:...|..:::.:|:..|..|:.......||.:|.||||.||||:
plant    67 FTHTVKDKNTDVQTLLSIGGKDADKAVLASMASNSKNRKAFIDSSIDIARKKDFYGLDLAWEYPS 131

  Fly   172 QRKGKPADRENFVLLTKELR----EEFDEHG---LLLTSAIGASKKVIDEAYDVRQISRYLDYLH 229
                ...:..||..|.||.|    ||.|...   ||||:|:..|.....|.|.|:.|:..||:::
plant   132 ----NDVEMANFGKLVKEWRAAVVEESDRTNQLPLLLTAAVYYSPDYYGEEYPVQAIADNLDFVN 192

  Fly   230 IMCYDYHG-SWDRRVGYNAPLTAPADDP-LSVKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTLAS 292
            ||.||::| .|....|..|.|..|::.. .|....:...|:...|.:|.|:|..:.|..:.    
plant   193 IMAYDFYGPGWSPVTGPPAALFDPSNPAGRSGDSGLSKWLEAKLPAKKAVLGFSYCGWAWT---- 253

  Fly   293 GFLNDVSEGVGF----KGPYTREDGFLGYNEICQTLSNQTSGWTREWDPQTSQVLAKSERNVFTQ 353
              |.| :|..|:    .|.....||.:.|.:|...:.:  :|.....||.......    .|.|.
plant   254 --LED-AENNGYDAATDGAAISSDGSITYAKIRNYIID--NGAATFHDPAVIGFYC----YVGTT 309

  Fly   354 EINVVTYDSSRSIANKVLFAMSKRLAGVMVWSVDTDDFLGNCKL 397
            .|.   ||.::||.:||.:|..|.|.|...|.|..|   .||.|
plant   310 WIG---YDDNQSIVSKVRYAKLKGLLGYFSWHVGAD---YNCGL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 102/359 (28%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 106/369 (29%)
AT4G19750NP_193710.2 GH18_plant_chitinase_class_V 11..348 CDD:119358 106/369 (29%)
Glyco_18 14..342 CDD:214753 102/359 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.