DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and AT4G19740

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_193709.3 Gene:AT4G19740 / 827718 AraportID:AT4G19740 Length:211 Species:Arabidopsis thaliana


Alignment Length:160 Identity:45/160 - (28%)
Similarity:72/160 - (45%) Gaps:22/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 LVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKPADRENFVLLTKELREEFDEHG--- 198
            :.:|...|..|:....|..|...|.||||.||||    ....:..||..|.:|.|...:...   
plant     1 MASNRTSRESFISSSISIARSLGFYGLDLAWEYP----NNDVEMNNFGKLLQEWRSAVEVESQRT 61

  Fly   199 ----LLLTSAIGASKKVIDEAYDVRQISRYLDYLHIMCYDYHGSWDRRVG-----YNAPLTAPAD 254
                ||||:|:..:......:|.|:.|:|.||:::::.|:::| ....:|     |:..:..|..
plant    62 GIRPLLLTAAVYYTSDYNSVSYPVQAINRSLDWVNLIAYEFYG-LTTEIGPPAGLYDPSIKGPCG 125

  Fly   255 DPLSVKFSIDYLLKLGAPPEKLVMGLPFYG 284
            |.     .:.:.||.|.|.:|.|.|.|:.|
plant   126 DT-----GLKHWLKAGLPEKKAVFGFPYVG 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 45/160 (28%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 45/160 (28%)
AT4G19740NP_193709.3 GH18_chitinase-like <23..211 CDD:415847 40/138 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.