DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and AT4G19730

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_193708.1 Gene:AT4G19730 / 827717 AraportID:AT4G19730 Length:332 Species:Arabidopsis thaliana


Alignment Length:381 Identity:89/381 - (23%)
Similarity:158/381 - (41%) Gaps:81/381 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLLASTASSLWASVAARTGPLHDKVVVCYVSTWAVYRPEQGAYAIENFDPNLCTHVVYAFAGLD- 81
            ::|.|.::.:.||.....|...|.:.                 :.|.....|.||:..|||.|| 
plant     5 VILGSPSAEVKASYWFPDGETQDPIT-----------------SAETIPSALFTHLFCAFADLDA 52

  Fly    82 ------ITQAAIKSLDPWQDLKEEYGKGGYEKMTGLKRSHPHLKVSLAIGGWNEGSANYSTLVAN 140
                  ::||            .|:....:.:.  :|..:|.:|..|:|||.|..::.::::.:|
plant    53 NSHKVFVSQA------------HEFIFSTFTET--VKIRNPQVKTLLSIGGKNANNSAFASMASN 103

  Fly   141 NLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKPADRE--NFVLLTKELREEFDEHG----- 198
            :..|..|:.......|...|.||||.||||.      :|.|  :|..|..|||...:...     
plant   104 HQSRKTFIDSWIFIARSNGFHGLDLAWEYPY------SDHEMTDFGNLVGELRAAVEAESRRSSK 162

  Fly   199 --LLLTSAIGASKKVIDEAYDVRQISRYLDYLHIMCYDYHGSWDRRVGYNAPLTAPA-------- 253
              ||||:|:..|.......|.|:.:...||:::|:.||::|...     ::..|.|.        
plant   163 PTLLLTAAVYYSSVYKTFTYPVQVMRESLDWVNIIAYDFYGPVS-----SSKFTVPTAGLHVSSN 222

  Fly   254 DDPLSVKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTLA----SGFLNDVSEGVGFKGPYTREDGF 314
            ::..|....:...:|.|.|.:|.|:|..:.|..: ||.    :|: |..:.||........|||.
plant   223 NEGPSGDSGLKQWIKDGLPEKKAVLGFSYVGWAW-TLQNDKDTGY-NAAAAGVAKSEDDVSEDGS 285

  Fly   315 LGYNEICQTLSNQTSGWTREWDPQTSQVLAKSERNVFTQEINVVTYDSSRSIANKV 370
            :.|.:|.:.:.::.:  .:.:||:.      .....|.::| .:.|:.::|:..||
plant   286 INYAQINKFIRDEEA--AKVYDPKV------VGHYCFAKKI-WIGYEDTQSVEAKV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 83/357 (23%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 83/356 (23%)
AT4G19730NP_193708.1 GH18_chitinase-like 11..332 CDD:415847 85/373 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.