DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and AT4G19720

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001319998.1 Gene:AT4G19720 / 827716 AraportID:AT4G19720 Length:363 Species:Arabidopsis thaliana


Alignment Length:366 Identity:99/366 - (27%)
Similarity:163/366 - (44%) Gaps:77/366 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PEQGAYAIENFDPNLCTHVVYAFAGLD-ITQAAIKSLDPWQDLKEEYGKGGYEKMTG-----LKR 113
            |:..|..|   |..|.||:..|||.|| .|.:.:.|             |.:|:...     :|:
plant    26 PQSSAVLI---DSTLFTHLFCAFADLDPQTNSVVVS-------------GAHEQEFSNFTKIVKK 74

  Fly   114 SHPHLKVSLAIGGWNEGSANYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKPA 178
            .:||::..|:|||.|...:.::::.:|...|..|:....|..|.|.||||||.|:||..    ..
plant    75 KNPHVQTLLSIGGRNADKSAFASMASNPTSRKSFIWSAISSARYYRFDGLDLVWKYPKD----DV 135

  Fly   179 DRENFVLLTKELREEFDEHG-------LLLTSAIGASKKVIDEAYDVRQISRYLDYLHIMCYDYH 236
            :..||..|.::.||..::..       ||||:|:..|......:|.:|:|.:.||:::::.||::
plant   136 EMRNFGQLLEQWREAIEDDAERTERMPLLLTAAVYYSPVYDSVSYPIREIKKKLDWVNLIAYDFY 200

  Fly   237 GSWDRRVGYNAPLTAPADDPLSVK-----FSIDYLLKLGAPPEKLVMGLPFYGRTFKTLASGFLN 296
            .| ...:|..|.|.    ||.:.|     :.:...:|.|.|.:|.|:|.|:.|.|: :|.||  |
plant   201 SS-STTIGPPAALF----DPSNPKGPCGDYGLKEWIKAGLPAKKAVLGFPYVGWTW-SLGSG--N 257

  Fly   297 DVSEGVGFKGPYTREDGFLGYNEICQTLSNQTSGWTREWDPQTSQVLAKSERNVFTQEI------ 355
            |.:.    ....|..:|.:.|::|.:.:.:..:                  |.||...:      
plant   258 DAAT----SRVATSAEGSINYDQIKRLIVDHKA------------------RPVFDSTVVGDYCF 300

  Fly   356 ---NVVTYDSSRSIANKVLFAMSKRLAGVMVWSVDTDDFLG 393
               :::.||..:|:..||.:|..|.|.|...|.|..||..|
plant   301 AGTSLIGYDDHQSVVAKVKYAKQKGLLGYFSWHVGADDNFG 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 96/360 (27%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 99/366 (27%)
AT4G19720NP_001319998.1 GH18_plant_chitinase_class_V 3..343 CDD:119358 99/366 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.