DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and Ctbs

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_112285.1 Gene:Ctbs / 81652 RGDID:621338 Length:367 Species:Rattus norvegicus


Alignment Length:408 Identity:101/408 - (24%)
Similarity:160/408 - (39%) Gaps:74/408 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QLWLLLLLASTASSLWASVAARTGPLHDKVVV--CYVSTWAVYRPEQGAYAIENFDPNLCTHVVY 75
            :|.|||||                ||.:::..  |..|..::.||.:.....|          |:
  Rat     8 ELTLLLLL----------------PLLERLSAEDCPCSEASLCRPIRHHRDFE----------VF 46

  Fly    76 AFAGLDITQAAIKSLDPWQDLK--EEYGKGGYEKMTGLKRSHPHLKVSLAIGGWNEGSANYSTLV 138
            .|   |:.|...||.| |..:.  ..:||...|.|     .:.|.|.:..:   .:|......::
  Rat    47 VF---DVGQKTWKSYD-WSQITTVAVFGKYDSELM-----CYAHSKGARVV---LKGDVALKDII 99

  Fly   139 ANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKPADRENFVLLTKELREEF--DEHGLLL 201
             |...|..::.|..:..:..:.||:::|.|.......  .:.|....|.:|..|.|  :..|..:
  Rat   100 -NPTFRASWIAQKVALAKAQHMDGINIDIEQEVDCSS--PEYEALTALVRETTEGFHREIEGSQV 161

  Fly   202 TSAIGASKKVIDE-AYDVRQISRYLDYLHIMCYDYHGS-WDRRVG-----YNAPLTAPADDPLSV 259
            |..:..|.|.||: .|:...|:...|:|.:|.||.... |...:.     ||..||...|     
  Rat   162 TFDVAWSPKGIDKRCYNYTGIADACDFLFVMSYDEQSQIWSECIAAANAPYNQTLTGYGD----- 221

  Fly   260 KFSIDYLLKLGAPPEKLVMGLPFYGRTFKTLASGFLNDVS--EGVGFKG-PYTREDGF-LGYNEI 320
                  .|::|..|.|||||:|:||..:..|... .:||.  ..|.|:| |.:...|. :.|..|
  Rat   222 ------YLRMGISPRKLVMGIPWYGYDYICLNLS-KDDVCAIAKVPFRGAPCSDAAGHQVPYRVI 279

  Fly   321 CQTLSNQTSGWTREWDPQTSQVLAKSERNVFTQEINVVTYDSSRSIANKVLFAMSKRLAGVMVWS 385
            .:.:::..||.....|.|......|..    |..::.|.||:.|||:.|..|.....|.|:.:|:
  Rat   280 MKQVNSSVSGSQWNQDQQAPYYNYKDP----TGRLHQVWYDNPRSISLKAAFVKHYGLRGIGMWN 340

  Fly   386 VDTDDFLGNCKLDEDTYE 403
            .:..|:..:....|.|.|
  Rat   341 ANCLDYSDDALAREQTEE 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 89/363 (25%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 93/378 (25%)
CtbsNP_112285.1 GH18_chitobiase 23..363 CDD:119354 93/377 (25%)
Glyco_18 <100..343 CDD:214753 69/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D369121at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.