DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and ctbs

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001018565.1 Gene:ctbs / 553763 ZFINID:ZDB-GENE-050522-422 Length:361 Species:Danio rerio


Alignment Length:417 Identity:99/417 - (23%)
Similarity:159/417 - (38%) Gaps:111/417 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LWLLLLLASTASSLWASVAARTGPLHDKVVVCYVSTWAVYRPEQGAYAIENFDPNLCTHVVYAFA 78
            |.|.:|:.:....:|:.             ||......:.:|.....|.|          |:.| 
Zfish     3 LTLSILVLTFCVQVWSK-------------VCPCERKELCQPISSQPAFE----------VFVF- 43

  Fly    79 GLDITQAAIKSLDPWQDLKEEYGKGGYEKMTGLKRSHPHLK-VSLAIGG---------------W 127
              |:.:.|.|..| |..:......|.|:...   ..:.|.| |.|.:.|               |
Zfish    44 --DVGEKAWKFYD-WTKVTTIAAFGQYDAEL---MCYAHSKGVRLVLKGDIRLPEIVDPVNRTAW 102

  Fly   128 NEGSANYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKPADRENFVL--LTKEL 190
            .:|:.        .|.:.:|:            ||:::|.|...: .|.|   |.:.|  |.||.
Zfish   103 IQGNV--------KLAKSQFM------------DGINIDIEQAVE-TGSP---EYYALTDLVKET 143

  Fly   191 REEFDEH--GLLLTSAIGASKKVIDE-AYDVRQISRYLDYLHIMCYDYHGS-WDRRVGYNAPLTA 251
            .|.|...  |..::..:..|.|.||: .||...|:...|.|.:|.||.... |...:   |...|
Zfish   144 TESFHTEIPGSQVSFDVAWSPKCIDKRCYDYITIADSCDLLFVMSYDEQSQIWGDCI---AMANA 205

  Fly   252 PADDPLSVKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTLASGFLNDVSEG------VGFKG-PYT 309
            |.|..|:   :.|..:.:...|:|||||:|:||..:..     ||...:|      |.|:| |.:
Zfish   206 PYDQTLT---AYDQYISMNIDPKKLVMGVPWYGYDYSC-----LNFSKDGVCTIPKVPFRGAPCS 262

  Fly   310 REDG-FLGYNEICQTLSNQTSGWTREWDPQTSQVLAKSER----NVFTQE--INVVTYDSSRSIA 367
            ...| .:.|:.:.:.:::..||  |.||        :.:|    |....|  ::.|.||...|||
Zfish   263 DASGRQIPYSIMMKQINSSISG--RLWD--------EEQRAPYYNYKDTEGMVHQVWYDDPESIA 317

  Fly   368 NKVLFAMSKRLAGVMVWSVDTDDFLGN 394
            .|..:.|...|.|:.:|:.:..|:.|:
Zfish   318 LKAAYVMQHGLKGIGMWNGNLLDYNGD 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 93/382 (24%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 95/388 (24%)
ctbsNP_001018565.1 GH18_chitobiase 5..358 CDD:119354 98/415 (24%)
Glyco_18 <95..334 CDD:214753 73/283 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D369121at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.