DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and Cht4

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster


Alignment Length:427 Identity:166/427 - (38%)
Similarity:234/427 - (54%) Gaps:74/427 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LW----LLLLLASTASSLWASVAARTGPLHDKVVVCYVSTWAVYRPEQGAYAIENFDPNLCTHVV 74
            :|    |.|.|...|||             :|::.||..|||.|||..|.:...:.||:||||:.
  Fly     6 IWALAALCLCLGQVASS-------------EKLLNCYWGTWANYRPGDGKFTPSDIDPSLCTHIS 57

  Fly    75 YAFAGLDITQAAIKSLDPWQDLKEEYGKGGYEKMTGLKRSHPHLKVSLAIGGWNEGSANYSTLVA 139
            |.|.|:. .....||||.|.|:.:  |.|...:...||:.:|:||:...:|||||||..||.:.|
  Fly    58 YTFFGIS-DAGEFKSLDTWLDMDD--GLGFISQTIALKQRNPNLKILAVVGGWNEGSTKYSAMAA 119

  Fly   140 NNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKPADRENFVLLTKELREEFDEHGLLLTSA 204
            :...|..||....:||::|:|||||||||||.||.|..|||||||.|.:|::|.:|::||.|..|
  Fly   120 DPAKRATFVSTSLAFIQQYSFDGLDLDWEYPGQRGGSEADRENFVTLLREIKETYDQYGLELGIA 184

  Fly   205 IGASKKVIDEAYDVRQISRYLDYLHIMCYDYHGSWDRRVGYNAPLTAPADDPLSVKFSIDYLLKL 269
            :|||:|....:||:..||::|.::::|.||:|.:.|..:|.||||...|:       ||||.|..
  Fly   185 VGASEKSASISYDIPAISQHLTFINVMTYDFHMALDGYLGLNAPLPEVAE-------SIDYWLSH 242

  Fly   270 GAPPEKLVMGLPFYGRTFKTLASGFLNDVSE--------GVGFKGPYTREDGFLGYNEICQTLSN 326
            |||.|||::|:.|||.:::      ::|.|:        |.|..|.||||:|||||:|||  |:|
  Fly   243 GAPAEKLILGIGFYGHSYQ------MSDSSQNWPGAACIGPGTAGVYTRENGFLGYHEIC--LNN 299

  Fly   327 QTSGWTREWDPQTSQVLAKSERNVFTQEINVVTYDSSRSIANKVLFAMSKRLAGVMVWSVDTDDF 391
                |...:|.:.....|       .|....:.||:..||..|:....|:.|.|.|:||::||||
  Fly   300 ----WQTVFDQENGAPYA-------FQGDQWIGYDNPESIQLKMQLVESRNLGGAMMWSIETDDF 353

  Fly   392 LGNCKLDEDTYEDFQKVTAAPKRSSQNYPLLRTINEA 428
            .|.|                    .::||||:|:|.|
  Fly   354 RGLC--------------------GESYPLLKTMNRA 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 145/354 (41%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 157/392 (40%)
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 158/394 (40%)
Glyco_18 28..351 CDD:214753 145/351 (41%)
CBM_14 421..462 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D48394at33392
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
98.970

Return to query results.
Submit another query.