DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and ctbs

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001011500.1 Gene:ctbs / 497004 XenbaseID:XB-GENE-975891 Length:369 Species:Xenopus tropicalis


Alignment Length:259 Identity:74/259 - (28%)
Similarity:114/259 - (44%) Gaps:28/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 RGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKPADRENFVL--LTKELREEFDEH--GLLLTSA 204
            |..::.|.....:....||::||.| .:..||.|   |.:.|  |.:|..|.|...  |..:|..
 Frog   105 RTSWITQKVELAKSQFMDGINLDIE-QSVLKGSP---EYYALTALVEETTEAFHREIPGSQVTFD 165

  Fly   205 IGASKKVIDE-AYDVRQISRYLDYLHIMCYDYHGS-WDRRVGYNAPLTAPADDPLSVKFS-IDYL 266
            :..|...:|| .|:...|:...|:|.:|.||.... |...|       |.|:.||:...| ....
 Frog   166 VAWSPDCVDERCYNYTGIAESCDFLFVMSYDEQSQIWTECV-------ASANSPLNKTLSGYQKF 223

  Fly   267 LKLGAPPEKLVMGLPFYGRTFKTLASGFLNDVSEGVGFKG-PYTREDG-FLGYNEICQTLSNQTS 329
            .:|...|:|||||:|:||..:..|.....|...:.|.|:| |.:...| .:.|::|.:.:::..:
 Frog   224 TQLDIDPKKLVMGVPWYGYDYPCLDLEDNNCTLKEVPFRGAPCSDAAGKQIPYSKITKQVNSSLT 288

  Fly   330 GWTREWDP-QTSQVL-AKSERNVFTQEINVVTYDSSRSIANKVLFAMSKRLAGVMVWSVDTDDF 391
            |  |.||. |.|... .|..:..|.|    |.||...||:.|..:.....|.|:.:|:.|..|:
 Frog   289 G--RLWDDVQKSPFYNYKDAKGQFHQ----VWYDDPVSISLKSAYIKKLGLRGIGMWNGDLLDY 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 73/255 (29%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 74/259 (29%)
ctbsNP_001011500.1 GH18_chitobiase 9..363 CDD:119354 74/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D369121at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.