DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and LOC4576330

DIOPT Version :10

Sequence 1:NP_477298.2 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_061501459.1 Gene:LOC4576330 / 4576330 VectorBaseID:AGAMI1_010339 Length:350 Species:Anopheles gambiae


Alignment Length:31 Identity:12/31 - (38%)
Similarity:14/31 - (45%) Gaps:11/31 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 PEKLVMGLP------FY----GRTFKTLASG 293
            |.|.|: ||      ||    ||..:||..|
Mosquito    46 PAKPVL-LPGPTCDRFYKCESGRACETLCPG 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_477298.2 GH18_chitolectin_chitotriosidase 43..428 CDD:119351 12/31 (39%)
LOC4576330XP_061501459.1 None

Return to query results.
Submit another query.