DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and Cht8

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster


Alignment Length:474 Identity:172/474 - (36%)
Similarity:251/474 - (52%) Gaps:59/474 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSGEAPQLWLLLLLASTASSLWASVAARTGPLHDKVVVCYVSTWAVYRPEQGAYAIENFDPNLCT 71
            :||....|..::|:|:::|:...|         .|.||||..||:||||..|.:.:|:.||.|||
  Fly     4 VSGLVKLLLGVILMAASSSAQGNS---------SKNVVCYQGTWSVYRPGLGKFGMEDIDPFLCT 59

  Fly    72 HVVYAFAGLDITQAAIKSLDPWQDLKEEYGKGGYEKMTGLKRSHPHLKVSLAIGGWNEGSANYST 136
            |::|||.|::.| ..::.:|.:.||:|..|:|..:....||..:|.||..:|:|||||||..:|.
  Fly    60 HLIYAFLGIEET-GQLRVIDAYLDLEENSGRGNIKSFNALKLKNPVLKTLVAVGGWNEGSKRFSL 123

  Fly   137 LVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKG-KPADRENFVLLTKELREEFDEHGLL 200
            :..:...|.:||..|..|::::.|||||||||||.||.. ...||.|::...|||:|..:..|.:
  Fly   124 VARDPSKREKFVDDVVRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYITFLKELKEGLEPFGFI 188

  Fly   201 LTSAIGASKKVIDEAYDVRQISRYLDYLHIMCYDYHGSWDRRVGYNAPLTAPADD---------P 256
            |::|:|:::...:.:||:..:..|||.:::|.||.||.||:.||.||||.|...|         .
  Fly   189 LSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYDLHGPWDQVVGINAPLYAAEKDASDSSGRQQQ 253

  Fly   257 LSVKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTLASGFLNDVSE---GVGFKGPYTREDGFLGYN 318
            |:|...:.|.||.|||.|||::|:|||||:| |||:...|....   |.|..|.|:||.|.||||
  Fly   254 LNVDAVVKYWLKAGAPAEKLILGVPFYGRSF-TLATAEGNQPGAPHIGKGIAGNYSREPGVLGYN 317

  Fly   319 EICQTLSNQTSGWTREWDPQTSQVLAKSERNVFTQEINVVTYDSSRSIANKVLFAMSKRLAGVMV 383
            |:|:.:..:.  ||::|:.......|..:|       ..|.|:..||:|.|..:.|...|.|:|:
  Fly   318 ELCEMMEREE--WTQKWEATQQVPYAYRQR-------QWVGYEDPRSLALKAQYVMDNHLGGIMI 373

  Fly   384 WSVDTDDFLGNCKLDEDTYEDFQKVTAAPKRSSQNYPLLRTINEATM--LAVDELAVPEPQPDDS 446
            ||:::|||.|.|                   ..|.||||..||....  .....|.....:...|
  Fly   374 WSLESDDFRGTC-------------------GQQPYPLLHEINRVLFGGNTPSGLTTESNRESPS 419

  Fly   447 EN-----EIPHGSIADRKN 460
            |.     :.|.|.|.|..|
  Fly   420 EGFSCPADAPAGYIRDPDN 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 144/359 (40%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 156/397 (39%)
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 156/398 (39%)
Glyco_18 31..379 CDD:214753 144/358 (40%)
CBM_14 424..476 CDD:279884 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D48394at33392
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
98.970

Return to query results.
Submit another query.