DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and Cht10

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster


Alignment Length:419 Identity:161/419 - (38%)
Similarity:226/419 - (53%) Gaps:60/419 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VVCYVSTWAVYRPEQGAYAIENFDPNLCTHVVYAFAGLDITQAAIKSLDPWQDLKEEYGKGGYEK 107
            ||||.::||.||..||.:..|:.|.|||||::|.||.||.....||:.|.|.|:...:    ||:
  Fly  1910 VVCYFTSWAWYRSSQGKFVPEDIDANLCTHLIYGFAVLDSKSLTIKTHDSWTDIDNRF----YER 1970

  Fly   108 MTGLKRSHPHLKVSLAIGGWNEG-SANYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYP- 170
            :...|:.  .|:|.|||||||:. .:.|:.||.|:..|.|||..|.||:.::.|:||||.||:| 
  Fly  1971 VVEYKQR--GLRVMLAIGGWNDSLGSKYARLVLNSQSRRRFVASVISFLEQHGFEGLDLAWEFPV 2033

  Fly   171 ----TQRKGKPADRENFVLLTKELREEFDEHGLLLTSAIGASKKVIDEAYDVRQISRYLDYLHIM 231
                ...:|.|.:::.||.|.|||.|.|.|:||:|::|:..||.|||..|:|.::|.|.|::.:|
  Fly  2034 CWQVNCNRGNPTEKDGFVALVKELSEAFKENGLILSAAVSPSKMVIDAGYNVFELSPYFDWVAVM 2098

  Fly   232 CYDYHGSWDRRVGYNAPLTAPADDP---LSVKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTLAS- 292
            .||:||.||.|.|..|||.....|.   |:..|||.|.|:.|.|.:|||||:|.||:|| |||. 
  Fly  2099 TYDFHGHWDMRTGQIAPLFHRGGDENLYLNGNFSIHYWLERGIPNDKLVMGMPMYGQTF-TLADQ 2162

  Fly   293 --GFLNDVSEGVGFKGPYTREDGFLGYNEICQTLSNQTSGWTREWDPQTSQVLAKSERNVFTQEI 355
              ..|||.:.|.|..|.:||.||||.|.|||:.:.|.      :|.      :.:.|..:|....
  Fly  2163 NRRSLNDKTVGPGKAGTFTRADGFLAYYEICEKVVND------DWK------VVRDEEGIFGSYA 2215

  Fly   356 ----NVVTYDSSRSIANKVLFAMSKRLAGVMVWSVDTDDFLGNCKLDEDTYEDFQKVTAAPKRSS 416
                ..::||...:|..|..|..|.:|.|.|:|::|.|||.|.|                   ..
  Fly  2216 YSGNQWISYDDVTTIRRKSQFIKSLQLGGGMIWALDLDDFRGLC-------------------GC 2261

  Fly   417 QNYPLLRTINEATMLAVDELAVPEPQPDD 445
            ..:|||||:::      :.|.:|..:..|
  Fly  2262 GKHPLLRTLSQ------ELLGIPGQKAKD 2284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 148/361 (41%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 158/400 (40%)
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753 148/361 (41%)
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351 158/407 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8303
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.