DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and chia.6

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_955897.2 Gene:chia.6 / 322420 ZFINID:ZDB-GENE-030131-1140 Length:480 Species:Danio rerio


Alignment Length:416 Identity:144/416 - (34%)
Similarity:213/416 - (51%) Gaps:56/416 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VVCYVSTWAVYRPEQGAYAIENFDPNLCTHVVYAFAGLDITQAAIKSLDPWQDLKEEYGKGGYEK 107
            :|||.:.|:.|||:.|.|...|.||:||||::|||:.:: .:..:.:.: |.|      :..|:.
Zfish    23 LVCYFTNWSQYRPDVGKYMPSNVDPHLCTHLIYAFSIIN-NENKLTTYE-WND------ETLYQS 79

  Fly   108 MTGLKRSHPHLKVSLAIGGWNEGSANYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQ 172
            ..|||:|:|:||..||:||||.|:..:|::|:....|..|::...:|:|.:.|||||||||||..
Zfish    80 FNGLKQSNPNLKTLLAVGGWNFGTTQFSSMVSTPQNRQTFIQSSITFLRTHGFDGLDLDWEYPGS 144

  Fly   173 RKGKPADRENFVLLTKELREEFDEHG-------LLLTSAIGASKKVIDEAYDVRQISRYLDYLHI 230
            |...|.|::.|.||.|||.|.:....       |:||:|:.|.|..||..|::.:|::|||:::|
Zfish   145 RGSPPEDKQRFTLLCKELVEAYQAESAATGRPRLMLTAAVAAGKGNIDAGYEIAEIAKYLDFINI 209

  Fly   231 MCYDYHGSWDRRVGYNAPLTAPADD-----PLSVKFSIDYLLKLGAPPEKLVMGLPFYGRTFK-- 288
            |.||:||||:...|:|:||...:.|     ..:..|::.|....|||.|||.||...|||||:  
Zfish   210 MTYDFHGSWESVTGHNSPLYRGSGDIGDKIYYNTDFAMTYWRDQGAPVEKLRMGFAAYGRTFRLS 274

  Fly   289 TLASGFLNDVSEGVGFKGPYTREDGFLGYNEICQTLSNQTSGWTREWDPQTSQVLAKSERNVFTQ 353
            :..|| :...:.|....|.||||.||..|.|||..|..           .|.|.:...:....|:
Zfish   275 SAVSG-VGAPASGAASAGTYTREAGFWSYYEICTFLKQ-----------ATVQQIVDQKVPYATK 327

  Fly   354 EINVVTYDSSRSIANKVLFAMSKRLAGVMVWSVDTDDFLGN-CKLDEDTYEDFQKVTAAPKRSSQ 417
            ....|.:|:..|...||.:...|...|..||::|.|||.|. |                   ...
Zfish   328 GQEWVGFDNMESYKTKVDYLKEKGFGGAFVWALDLDDFSGQFC-------------------GQS 373

  Fly   418 NYPLLRTINEATMLAVDELAVPEPQP 443
            .|||:..:.  |:|.::....|...|
Zfish   374 KYPLIGQLR--TLLNINNTEFPYNPP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 132/359 (37%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 140/399 (35%)
chia.6NP_955897.2 Glyco_18 22..363 CDD:214753 132/359 (37%)
GH18_chitolectin_chitotriosidase 23..385 CDD:119351 141/402 (35%)
CBM_14 433..479 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.