DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and Cht12

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster


Alignment Length:395 Identity:121/395 - (30%)
Similarity:188/395 - (47%) Gaps:54/395 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VVCYVSTWAVYRPEQGAYAIENFDPNLCTHVVYAFA-GLDITQAAIKSLDPWQDLKEEYGKGGYE 106
            |.|.....:.|...:..:...:.|..||||:|.... |:|.....::..|....|::       :
  Fly    25 VFCQYDLGSYYYKGRSQFFEWHLDSRLCTHLVLGSGIGVDGDSGELRITDKILLLEK-------D 82

  Fly   107 KMTGLK--RSHPHLKVSLAIGGWNEGSANYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEY 169
            |::.:|  :.....||...||||.|.|:::|.:||:...|..|...:..|:.::.|||:.:||.|
  Fly    83 KLSSVKTMKWDSIKKVMFTIGGWEEDSSSFSRMVASPKKRDNFYSSMLEFMFRWGFDGVQIDWRY 147

  Fly   170 PTQRKGKPADRENFVLLTKELREEFDEHGLLLTSAI-GASKKVIDEAYDVRQISRYLDYLHIMCY 233
            ||...|.|.||:|||:|.:||...|.::.|:|..|: |.....|.|:|::.:|..:.|::|:|.:
  Fly   148 PTLLGGHPDDRQNFVILLEELGLIFRKNQLILMVAVLGRRDNRILESYNIPEIVNHSDFIHLMMH 212

  Fly   234 DYHGSWDRRVGYNAPLTAPADDPLSVKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTLASGFLNDV 298
            |....:..|:.|||||.....   ||..||.:..:.|..||||::|:|.:.|:| |:..   |..
  Fly   213 DEQDPYHLRLAYNAPLVGYEG---SVTDSIMHWKRNGGAPEKLILGIPLFVRSF-TMDR---NQS 270

  Fly   299 SEGVGFKGP-----YTREDGFLGYNEICQTLSNQTSGWTREWDPQTSQVLAKSERNVFTQEINVV 358
            :.|...|||     .:...||:.|||.|.    |.|.|:|.:|.     |||..  ..|:....|
  Fly   271 TVGSACKGPGRQTKQSHRPGFMTYNEWCV----QQSKWSRMFDQ-----LAKVP--YATRGDQWV 324

  Fly   359 TYDSSRSIANKVLFAMSKRLAGVMVWSVDTDDFLGNCKLDEDTYEDFQKVTAAPKRSSQNYPLLR 423
            :|::.|||..|:......:|.|.|.|::|.|||.|.|                    .:.:.|||
  Fly   325 SYENPRSIWAKMHLLQEHKLGGAMAWTIDVDDFRGRC--------------------GEQHGLLR 369

  Fly   424 TINEA 428
            .|..|
  Fly   370 VIFSA 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 111/354 (31%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 120/393 (31%)
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 121/395 (31%)
Glyco_hydro_18 47..355 CDD:279094 108/332 (33%)
ChtBD2 394..438 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - otm46727
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
76.960

Return to query results.
Submit another query.