DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and chil-26

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001317724.1 Gene:chil-26 / 188615 WormBaseID:WBGene00011847 Length:345 Species:Caenorhabditis elegans


Alignment Length:365 Identity:71/365 - (19%)
Similarity:124/365 - (33%) Gaps:134/365 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FDPNLCTHVVYAFAGLDIT-----QAAIKSLDPWQDLKEEYGKGGYEKMTGLKRSHPHLKVS--- 121
            ||    |:.|:|||.|:..     ::||..                :|...|.|...|:..:   
 Worm    80 FD----TYAVFAFAQLNTNGSLQFESAISK----------------QKFLNLNRKSKHINNNVNR 124

  Fly   122 -LAIGGWNEGSANYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKPADRENFVL 185
             |:|||.|. |...|.::.:.....||:..:..|::....||::|.|...|:             
 Worm   125 ILSIGGTNY-SEKLSIMLQDLKKTRRFIMSIIRFLKDNELDGVELLWNRNTE------------- 175

  Fly   186 LTKELREEFDEHGLLLTSAIGASKKVIDEAYDVRQISRYLDYLHIMCYDYHGSWDRRVGYNAPLT 250
              :.|..|..:|     ..:|..|:....:..:|.....:...||.|       :.....||   
 Worm   176 --ETLYCELLQH-----LKMGLEKQEKQYSISLRVPQTGIGKWHIGC-------ELEDQENA--- 223

  Fly   251 APADDPLSVKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTLASGFLNDVSE--GVGFKGPYTREDG 313
                |.:::....:|        |..:.|            ||.:..:||  ...::..|     
 Worm   224 ----DSINLISMAEY--------ENQLFG------------SGGVIRISEAFNTAWEMKY----- 259

  Fly   314 FLGYNEICQTLSNQTSGW---------TRE------WDPQTSQVLAKSERNVFTQEINVVTYDSS 363
                 ..|.  |||:|.:         |.:      |:|:..::          |..|    .|:
 Worm   260 -----HACN--SNQSSKFNLVIPTIEQTEQIDMQYVWNPEKKEI----------QRFN----SST 303

  Fly   364 RSIANKVLFAMSKRLAGVMVWSVDTDDFLGNCKLDEDTYE 403
            ::...|:      ::.||.:||.|. |:..|.:||...:|
 Worm   304 KTEYTKL------QMGGVSIWSRDM-DYHNNIQLDSYFFE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 66/349 (19%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 71/365 (19%)
chil-26NP_001317724.1 Glyco_18 82..323 CDD:214753 64/344 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D369121at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.