DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and chil-23

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001254212.1 Gene:chil-23 / 187739 WormBaseID:WBGene00011167 Length:432 Species:Caenorhabditis elegans


Alignment Length:419 Identity:87/419 - (20%)
Similarity:167/419 - (39%) Gaps:117/419 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PLHDKVVVCYVSTWAVYRPEQGAYAIENFDPNLCTHVVYAFAGL--DITQAAIKSLDPWQDLK-E 98
            |:.||.::.|.|       ..|...|.:...:..||.|:||..:  |.|......::..:.|| :
 Worm    69 PICDKRIIGYYS-------GSGTSNITSTQLSNLTHTVFAFVYMTPDGTLLFNNQIEKNRFLKLK 126

  Fly    99 EYGKGGYEKMTGLKRSHPHLKVSLAIGGWNEGSANYSTLVANNLLRGRFVKQVSSFIRKYNFDGL 163
            |..:.|..|          :|:..:||| .:.|..:|:::.:......|::.:..|:..|:.||:
 Worm   127 EVVRNGNSK----------IKLMFSIGG-KDNSKYFSSVIPSEERIQTFIESILEFLEAYDLDGV 180

  Fly   164 DLDWEYPTQRKGKPADRENFVLLTKELREEFD--EHGLLLTSAI------GASKKVIDEAYDVRQ 220
            ||.|::|.:..     |:.:.....:||:.|:  :...:|:..|      |..||.::      :
 Worm   181 DLFWKWPEEEY-----RDAYFAFINQLRKTFEAKKKYYILSIVIPPPTLDGWGKKRLN------K 234

  Fly   221 ISRYLDYLHIMCYDYH-----------------------GSWDRRVGYNAP----LTAPADDPLS 258
            |...:|:::....||:                       |..:|.|.:.|.    ||..|.    
 Worm   235 IIESVDFINAYSTDYYTPLADNLSDDIAGPSAPIYFGAQGKSERNVHHTARNYSCLTKQAS---- 295

  Fly   259 VKFS--IDYLLKLGAPPEKLVMG---------LPFYGRTFKTLASGFLNDVSEGVGFKGPYTRED 312
             ||:  |.:...|.....:.|:.         .|||||   |:...:|:.::         .:::
 Worm   296 -KFNIVIPFYATLWENVYETVLDSKRGVYRHVAPFYGR---TVGKTYLSRLA---------VKQE 347

  Fly   313 GFLGYNEICQTLSNQTSGWTREWDPQTSQVLAKSERNVFTQEINV-VTYDSSRSIANKVLFAMSK 376
            ||            |...::  :||......:      :.:.|.: :|:::..||..|:.:...:
 Worm   348 GF------------QVESYS--YDPAPRAAFS------YNRTIGIYLTFETKESIRAKIDYVKDR 392

  Fly   377 RLAGVMVWSVDTDDFLGNCKLDEDTYEDF 405
            .|.||.::|||.||.. |.:|...:::.|
 Worm   393 ILGGVWIFSVDMDDET-NSQLKAVSFDGF 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 79/396 (20%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 84/413 (20%)
chil-23NP_001254212.1 Glyco_18 74..405 CDD:214753 79/396 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.