DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and K08F9.3

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001263897.1 Gene:K08F9.3 / 187168 WormBaseID:WBGene00010686 Length:287 Species:Caenorhabditis elegans


Alignment Length:229 Identity:52/229 - (22%)
Similarity:94/229 - (41%) Gaps:53/229 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LWLLLLLASTASSLWAS--VAARTGPLHDKVVVCYVSTWAVYRPEQGAYAIENFDPNLCTHVVYA 76
            |:|.:|:....|.:..|  |.:.|....||.::.|      |...:|...:||...|| ||.|: 
 Worm    93 LFLFVLIFGIYSLVSHSGHVQSTTPDQCDKQLIGY------YNGIEGRNILENQFHNL-THAVF- 149

  Fly    77 FAGLDITQAAIKSLDPWQDLKEEYGKGGYEKMTGLKRSHPHLKVSLAIGGWNEGSANYSTLVANN 141
                  |...:.....:::..:|  :...|....|..|:...|:.:|: |:|:||..        
 Worm   150 ------TSEFVNENGSFENSHKE--QEFLECRKKLGESNSTAKIMIAM-GFNKGSCK-------- 197

  Fly   142 LLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKPADRENFVL---LTKELR---EEFDEHGLL 200
                  :..::|||.||..||::|.|.:          .|:|:.   .|:.|:   ::.....||
 Worm   198 ------IDCITSFIEKYQVDGVELHWNH----------NEHFLSQLETTRNLKNRLKKISNSKLL 246

  Fly   201 LTSAIGASKKVIDEAYDVRQISRYLDYLHIMCYD 234
            ..||.....:|.    ::.|:....|:::|..:|
 Worm   247 GVSASSNWSRVT----ELDQVLEVADFVNIELHD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 43/199 (22%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 43/198 (22%)
K08F9.3NP_001263897.1 Glyco_hydro_18 122..>272 CDD:279094 42/194 (22%)
GH18_chitinase-like 124..276 CDD:299167 42/196 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.