DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and chil-7

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_496131.2 Gene:chil-7 / 182437 WormBaseID:WBGene00007472 Length:482 Species:Caenorhabditis elegans


Alignment Length:305 Identity:76/305 - (24%)
Similarity:137/305 - (44%) Gaps:67/305 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 HLKVSLAIGGWNEGSANYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKPADRE 181
            ::||..:||| ::.:.:|||:||::..|..|:..:.|||:..|..|:||.||:|     ..::..
 Worm   186 NVKVMFSIGG-HKNAEHYSTVVADSTKRSVFIDSIVSFIKSNNASGVDLFWEWP-----NISEMN 244

  Fly   182 NFVLLTKELREEFDEHGLLLTSAIGASKKVI----------DEAYDVRQ--ISRYLDYLHIMCYD 234
            :|:...||||::.    ..||.|.....:.:          |..|.:|.  :..|:|:|:::.|.
 Worm   245 DFITTIKELRKKL----AALTKAQPKGTRYLLSIIVPSSPSDLEYYLRMDGLLHYVDFLNVLTYG 305

  Fly   235 YHGSWD----RRVGYNAPLTAPADDPLSVKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTL----- 290
            |:..|.    :.||.||||.....:  :|..::.||:.....|.||.|.|.||||.::.:     
 Worm   306 YYAPWSGVNGKFVGPNAPLYGGNRE--NVDETMQYLICKTRTPSKLNMALSFYGRYWENVNDNVP 368

  Fly   291 -----ASGFLNDVSEGVGFKGPYTREDGFLGYNEICQTLSNQTSGWTRE---WDPQTS--QVLAK 345
                 .:..:|..::|:           |:.:..:.      ..||.:.   |..:|.  .:...
 Worm   369 DEMFKEADLINGKAQGM-----------FVAWKNLA------GRGWDKSEALWHEETQIPYIWNS 416

  Fly   346 SERNVFTQEINVVTYDSSRSIANKVLFAMSKRLAGVMVWSVDTDD 390
            .||..|       .:::.||:..|:.:|....:.||.:|::..||
 Worm   417 EERKFF-------VFENERSLQAKMDYAADHNIGGVYIWALGADD 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 74/302 (25%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 76/305 (25%)
chil-7NP_496131.2 Glyco_18 127..453 CDD:214753 74/302 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D369121at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.