DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and chil-3

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_496128.1 Gene:chil-3 / 182432 WormBaseID:WBGene00007467 Length:447 Species:Caenorhabditis elegans


Alignment Length:344 Identity:71/344 - (20%)
Similarity:144/344 - (41%) Gaps:66/344 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LCTHVVYAFAGLDITQAAIKSLDPWQDLKEEYGKGGYEKMTGLKRS-HPHLKVSLAIGGWNEGSA 132
            :.||::|.||         :..:....|..|..:..:::|....|. ...:||.:::|| ::.|.
 Worm   120 MVTHIIYLFA---------RPTNGVMTLDGERTRRKFQEMRSKAREVSSTVKVMISVGG-HDHSG 174

  Fly   133 NYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKPADRENFVLLTKELREEFDEH 197
            .:|.:::|...|..|:|.:.||::..:.||:::.|.:|..|     |..|:.:..::||.||.| 
 Worm   175 AFSAIMSNEASRSVFIKSIVSFVKNEDIDGIEIFWMWPKHR-----DVNNYSIFIQDLRNEFTE- 233

  Fly   198 GLLLTSAIGASKKVIDE---------AYDVRQISRYLDYLHIMCYDYHGSWDRRVGYNAPLTAPA 253
               |........:.|..         ::|.....:::|:.:|....:.   :::||.::||....
 Worm   234 ---LQKRTNRKNEYIISLLVPKKSYWSFDFEDFLKFVDFFNIYSTQFR---EKQVGPDSPLYGGE 292

  Fly   254 DDPL--SVKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTLASGFLNDVSEGVGFKGPYTREDGF-L 315
            ...:  ::|:   |..|.| .|.|..:.:.|:|..:|.......||..:  .||.....:..| :
 Worm   293 GRNIDETMKY---YTCKTG-QPSKFNIFVSFHGTFWKDAELPLRNDFDD--IFKDKNLTKGAFAV 351

  Fly   316 GYNEICQTLSNQTSGWTREWD---------PQTSQVLAKSERNVFTQEINVVTYDSSRSIANKVL 371
            .:.|:.|          ::|:         .:||.:........|      :|.:..||:..|..
 Worm   352 RWRELLQ----------QKWNLEDIKFHNLTKTSYIWIPGPPTWF------MTLEDKRSLREKTK 400

  Fly   372 FAMSKRLAGVMVWSVDTDD 390
            :.....:.|:.:|::|.||
 Worm   401 YVADYNIGGITMWTIDQDD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 69/341 (20%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 71/344 (21%)
chil-3NP_496128.1 Glyco_18 100..418 CDD:214753 69/341 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D369121at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.