DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and chil-2

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_496133.2 Gene:chil-2 / 182431 WormBaseID:WBGene00007466 Length:383 Species:Caenorhabditis elegans


Alignment Length:371 Identity:81/371 - (21%)
Similarity:161/371 - (43%) Gaps:87/371 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KVVVCYVSTWAVYRPEQGAYAIENFDPNLCTHVVYAFAGLDITQAAIKSLDPWQDLK--EEYGKG 103
            |.||.|           .|..:.|......||.::....: .....||    |.:.:  |.|.:.
 Worm    41 KRVVAY-----------SAKFLSNHQLKKLTHFIFTSISI-FPNGTIK----WPNCENFESYARK 89

  Fly   104 GYEKMTGLKRSHPHLKVSLAIGGWNEGSANYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWE 168
            .       |..:|:||:.:.|.|      .:.:::|.:..:..|:|.:|||:..:.|||:|:.|.
 Worm    90 A-------KMDNPNLKIMVEING------KFFSVLAEDEKKNSFIKSISSFVVDHKFDGVDIFWS 141

  Fly   169 YPTQRKGKPADRENFVLLTKELREEFDEHGLLLTSAIGASKKVIDEAYDVRQISRYLDYLHIMCY 233
            :       |.|.:.|.|..||.||:.::| ::::.||....:.: |.::::.:..::|:|:::..
 Worm   142 W-------PEDEDTFHLFIKEFREKLEKH-MIISIAIPRLAQQL-EGFNLKLLMNHIDFLNVLSI 197

  Fly   234 DYHGSWDRRVGYNAPLTAPADDPL------SVKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTLAS 292
            :|:...........|::     ||      :|..::.||..:...|..|.||:.|.|.       
 Worm   198 NYYEPLPGNGANIGPIS-----PLYGGQRGNVDGTLKYLTCITKRPSILNMGVTFTGI------- 250

  Fly   293 GFLNDVSEGVGFKGPYTR----EDG---FLGYNEICQTLSNQTSGW------TREWDPQTSQVLA 344
             |.|.|.:|:..:....:    |:|   .:|:.:..:...|....|      :..|||::...||
 Worm   251 -FWNGVKDGLNEQDDIWKVAQNENGPGKSIGWRKFIKDRRNTIPQWHDSSKSSYAWDPKSKIFLA 314

  Fly   345 KSERNVFTQEINVVTYDSSRSIANKVLFAMSKRLAGVMVWSVDTDD 390
                           :::.:|::.||::..:|.:.|:::|:||.||
 Worm   315 ---------------FENEKSLSEKVIYVRNKNIGGLVIWNVDQDD 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 78/367 (21%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 80/369 (22%)
chil-2NP_496133.2 Glyco_18 42..344 CDD:214753 78/367 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D369121at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.