DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and chil-1

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001040740.1 Gene:chil-1 / 182430 WormBaseID:WBGene00007465 Length:465 Species:Caenorhabditis elegans


Alignment Length:392 Identity:85/392 - (21%)
Similarity:163/392 - (41%) Gaps:98/392 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LCTHVVYAFA----GLDITQAAIKSLDPWQDLKEEYGKGGYEKMTGLKRSHPHLKVSLAIGGWNE 129
            :.||::|.||    |: ||....:||..::::|           :..:.:...||:.::||| :.
 Worm   138 MLTHIIYLFAIPRNGV-ITIVDDRSLRKFEEMK-----------SNAREASSTLKIMISIGG-HY 189

  Fly   130 GSANYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKPADRENFVLLTKELREEF 194
            .|.::|.||.|...|..||..:.||:.||:.||:::.|.:|..|     |:.|:::..:|||..|
 Worm   190 NSRSFSGLVFNETSRTVFVNSIVSFVEKYDIDGIEMFWMWPRYR-----DKNNYLMFIQELRYAF 249

  Fly   195 DEHGLLLT-------SAIGASKKVIDEAYDVRQISRYLDYLHIMCYDYHGSWDRRVGYNAPLTAP 252
            .|....|.       |.:.:|.  ::..:::.:....:|:..|..::   |:..:||.::||...
 Worm   250 TELQNKLNRKEDFVISLVASSN--LNLLFNLVEFLNSVDFFGIYLFN---SYSYQVGPDSPLYGG 309

  Fly   253 ADDPLS--VKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTLASGF---LNDVSEGVGFKGPYTRED 312
            ....:.  :|:   |:.|.| .|.|..:.:.|:.    |...|.   |.|.|:.: :|   ..|.
 Worm   310 GSRNVDEIMKY---YICKTG-QPSKFNIIISFHA----TYWEGTDLPLRDDSDNI-WK---VNES 362

  Fly   313 GFLGYNEICQTLSNQTSGWTREWD---------PQTSQVLAKSERNVFTQEINVVTYDSSRSIAN 368
            |.|......:.|.:      .:|:         .:||.:........|      :|.:..:|:..
 Worm   363 GRLAVALRWRELPH------HKWNLENIKFHNLTKTSYIWIPGPPTRF------LTLEDEQSLRE 415

  Fly   369 KVLFAMSKRLAGVMVWSVDTDDFLGNCKLDEDTYEDFQKVTAAPKRSSQNYPLLRTINEATMLAV 433
            |..:.....:.|:.:|::|.||       |:.|                   ||:.::.|.:...
 Worm   416 KNRYVADHNIGGITMWTIDQDD-------DDHT-------------------LLKVVSSAELCTG 454

  Fly   434 DE 435
            :|
 Worm   455 EE 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 77/344 (22%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 83/383 (22%)
chil-1NP_001040740.1 Glyco_18 118..436 CDD:214753 77/344 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D369121at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.