DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and btb-17

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_872000.1 Gene:btb-17 / 173673 WormBaseID:WBGene00018200 Length:321 Species:Caenorhabditis elegans


Alignment Length:205 Identity:43/205 - (20%)
Similarity:79/205 - (38%) Gaps:51/205 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 PADDPLSVKFSIDYL-LKLGAPPEKLVMG----------LPFYGRTFKTL-ASGFLNDVSEGVGF 304
            |..:||  :||.|.: |........||:|          |.::...|:.| :|.|..|..:.:..
 Worm   144 PWINPL--QFSFDEMFLSSKKNDAVLVIGERKLHVNKAFLSYHSDYFRALFSSNFKEDKQDEIEL 206

  Fly   305 KGPYTREDGFLGYNEICQTLSNQTSGWTREW--DPQTSQVLAKSERNVFTQEINVVTY---DSSR 364
            |.....:.|.|     ..|:..:|     |:  |....::|..::|.:....|:.|.|   .:||
 Worm   207 KDVVYEDFGLL-----MTTIYPKT-----EFPSDRTAEKILEMADRFMVQSAIDHVEYHLLHNSR 261

  Fly   365 SIANKVLFAMSKRLAGVMVWSVD---TDDFLGNCKLDEDTYEDFQKVTAAPKRSSQNYPLLRTIN 426
             |.|:           .|:|..|   .:..:....|..|:.|..:|:..:|...|.::       
 Worm   262 -ITNE-----------SMMWMADKYGMEKLMKKSILKMDSLEKAKKLKESPWFPSMSH------- 307

  Fly   427 EATMLAVDEL 436
            :|.::.::.|
 Worm   308 DAKVIVLERL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 35/156 (22%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 41/195 (21%)
btb-17NP_872000.1 BTB 164..260 CDD:197585 21/105 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.