Sequence 1: | NP_001246550.1 | Gene: | Cht2 / 38223 | FlyBaseID: | FBgn0022702 | Length: | 484 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_872000.1 | Gene: | btb-17 / 173673 | WormBaseID: | WBGene00018200 | Length: | 321 | Species: | Caenorhabditis elegans |
Alignment Length: | 205 | Identity: | 43/205 - (20%) |
---|---|---|---|
Similarity: | 79/205 - (38%) | Gaps: | 51/205 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 252 PADDPLSVKFSIDYL-LKLGAPPEKLVMG----------LPFYGRTFKTL-ASGFLNDVSEGVGF 304
Fly 305 KGPYTREDGFLGYNEICQTLSNQTSGWTREW--DPQTSQVLAKSERNVFTQEINVVTY---DSSR 364
Fly 365 SIANKVLFAMSKRLAGVMVWSVD---TDDFLGNCKLDEDTYEDFQKVTAAPKRSSQNYPLLRTIN 426
Fly 427 EATMLAVDEL 436 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cht2 | NP_001246550.1 | Glyco_18 | 42..389 | CDD:214753 | 35/156 (22%) |
GH18_chitolectin_chitotriosidase | 43..428 | CDD:119351 | 41/195 (21%) | ||
btb-17 | NP_872000.1 | BTB | 164..260 | CDD:197585 | 21/105 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3325 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |