DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and T19H5.6

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001254213.1 Gene:T19H5.6 / 13186491 WormBaseID:WBGene00044807 Length:286 Species:Caenorhabditis elegans


Alignment Length:268 Identity:55/268 - (20%)
Similarity:115/268 - (42%) Gaps:45/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RSRLSGEAPQLW-----LLLLLASTASSLWASVAART-------GP--LHDKVVVCYVSTWAVYR 54
            :::.|.|.|.:.     ::|::..:..:|...|..|:       .|  ...:|:..|..|     
 Worm    18 KTKKSAEKPSIHVGKYEIILIIFMSIVTLGLVVVIRSFVFVEENAPTVCEKRVIGYYAGT----- 77

  Fly    55 PEQGAYAIENFDPNLCTHVVYAFAGLDITQAAIKSLDPWQDLKEEYGKGGYEKMTGL-KRSHPHL 118
             |:....||  :.:..||.|:||..:        :.|.......:..:..:.|:..| |..:..:
 Worm    78 -EKSQITIE--EVSELTHAVFAFVYM--------ATDGTLMFSNQAQRNRFLKLKELTKNENSTV 131

  Fly   119 KVSLAIGGWNEGSANYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKPADRENF 183
            |:..:||| .:.|.|:|.:.|:...:..|:..:...:.||:.||:||.|.:|     |..|::.:
 Worm   132 KMMFSIGG-KDNSQNFSPVTASPDRKKSFINAILELLEKYDLDGVDLFWRWP-----KSDDKDEY 190

  Fly   184 VLLTKELREEFDEHGL-LLTSAIGASKKV--IDEAYDVRQISRYLDYLHIMCYDYHGSWDRRVGY 245
            .:..:||:::...... .:.|.:.|...:  .|..:|:::|.::.|::.|     :|........
 Worm   191 AVFLRELKKQLKARRKDYILSVVVAPLDINRWDSKFDIKKIIKHADFISI-----YGLAKNTTDS 250

  Fly   246 NAPLTAPA 253
            .:|:.|.|
 Worm   251 ESPMFASA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 47/216 (22%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 46/215 (21%)
T19H5.6NP_001254213.1 Glyco_18 69..>255 CDD:214753 45/212 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.