DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht2 and CHI3L1

DIOPT Version :9

Sequence 1:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001267.2 Gene:CHI3L1 / 1116 HGNCID:1932 Length:383 Species:Homo sapiens


Alignment Length:408 Identity:142/408 - (34%)
Similarity:213/408 - (52%) Gaps:74/408 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VVCYVSTWAVYRPEQGAYAIENFDPNLCTHVVYAFAGLDITQAAIKSLDPWQDLKEEYGKGGYEK 107
            :|||.::|:.||...|:...:..|..||||::|:||  :|:...|.:.: |.|:..      |..
Human    24 LVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFA--NISNDHIDTWE-WNDVTL------YGM 79

  Fly   108 MTGLKRSHPHLKVSLAIGGWNEGSANYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQ 172
            :..||..:|:||..|::||||.||..:|.:.:|...|..|:|.|..|:|.:.||||||.|.||.:
Human    80 LNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGR 144

  Fly   173 RKGKPADRENFVLLTKELREEFDEHG------LLLTSAIGASKKVIDEAYDVRQISRYLDYLHIM 231
            |     |:::|..|.||::.||.:..      |||::|:.|.|..||.:||:.:||::||::.||
Human   145 R-----DKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIM 204

  Fly   232 CYDYHGSWDRRVGYNAPLTAPADDPLSVKFS-----IDYLLKLGAPPEKLVMGLPFYGRTFKTLA 291
            .||:||:|....|:::||....:|....:||     :.|:|:||||..|||||:|.:||:| |||
Human   205 TYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSF-TLA 268

  Fly   292 S---GFLNDVSEGVGFKGPYTREDGFLGYNEICQTLSNQTSGWTREWDPQTSQVLAKSERNVFTQ 353
            |   |....:| |.|..|.:|:|.|.|.|.|||..|...|                  ...:..|
Human   269 SSETGVGAPIS-GPGIPGRFTKEAGTLAYYEICDFLRGAT------------------VHRILGQ 314

  Fly   354 EINVVT-------YDSSRSIANKVLFAMSKRLAGVMVWSVDTDDFLGN-CKLDEDTYEDFQKVTA 410
            ::...|       ||...|:.:||.:...::|||.|||::|.|||.|: |..|            
Human   315 QVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGSFCGQD------------ 367

  Fly   411 APKRSSQNYPLLRTINEA 428
                  ..:||...|.:|
Human   368 ------LRFPLTNAIKDA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 132/366 (36%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 141/406 (35%)
CHI3L1NP_001267.2 Glyco_18 23..357 CDD:214753 132/366 (36%)
GH18_chitolectin_chitotriosidase 24..380 CDD:119351 142/408 (35%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 70..71 0/1 (0%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 97..100 2/2 (100%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 204..207 1/2 (50%)
Important for AKT1 activation and IL8 production. /evidence=ECO:0000250 324..338 3/13 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.